Details for Lyrate rockcress Locus 16038579

Position : sca3 ( 5`- 1278401 .. 1275734 -3` )
Annotation : [B2G] fmn binding protein
External links : CoGe
PGDD synteny : 16038579

Protein [Map View]
MKSLVAHFSTPLITSRLFPTCLIHRASISAVNFPTVRRRYSPLTMASAAQSSSQAVSSGSVNSDTDVFKLIQAHEEKAAR
LSPVDEIRTVLNGSVRGMLSTFSQKYEGYPSGSMVDFACDADGSPILAVSSLAVHTKDLLANPKCSLLIARDPEDRTGLR
ITLHGDAVLVSEKDQAAVRSAYLAKHPSAFWVDFGDFSFMRIEPKVVRYVSGIATAFLGSGEFSKEKYQAAKVDPIAQYA
KPVTSHMNKDHEEDTKAIVHNVTSIPVESALMLDLDSLGFNVKASLQGNTFKLRVPFPRPAQDRKDVKTLIVEMLQAAKP
IPN*

DNA
ATGAAGTCGCTTGTAGCCCATTTTTCAACGCCTTTAATCACGTCTAGATTGTTCCCTACATGTCTTATTCATCGAGCTTC
AATCTCCGCCGTCAATTTTCCCACCGTCCGCCGCCGATATTCTCCTCTCACCATGGCCTCAGCAGCTCAGTCTTCTTCTC
AGGCTGTGTCATCGGGGAGTGTCAACAGTGATACAGATGTTTTCAAATTGATTCAAGCTCACGAGGAGAAGGCTGCTCGT
CTTTCTCCAGTTGACGAAATCCGGACTGTTCTTAATGGTAGTGTCCGTGGTATGCTTTCCACTTTTTCTCAGAAATATGA
GGGTTATCCTTCAGGGTCAATGGTTGATTTTGCATGTGATGCTGATGGTTCTCCGATTCTGGCAGTTAGTAGCTTGGCAG
TTCATACGAAGGATCTGCTAGCTAATCCAAAATGCTCATTACTAATTGCTAGAGACCCAGAGGATAGGACCGGTTTGAGG
ATCACCCTACATGGTGATGCAGTCCTGGTTTCTGAAAAAGATCAAGCGGCTGTTCGATCTGCCTATTTAGCCAAGCATCC
CAGTGCTTTCTGGGTTGATTTCGGGGACTTCAGTTTTATGCGAATCGAACCGAAAGTGGTTAGATATGTTTCAGGGATTG
CAACTGCTTTTCTAGGATCTGGAGAATTCAGCAAAGAGAAGTACCAAGCAGCCAAAGTCGATCCTATAGCTCAGTATGCA
AAGCCTGTGACGTCTCACATGAATAAAGACCATGAAGAGGATACCAAAGCCATAGTACACAATGTGACGTCCATACCTGT
CGAGAGCGCCTTGATGCTTGATTTGGACAGCCTTGGTTTCAACGTTAAGGCTAGTCTTCAAGGGAATACCTTCAAGCTCC
GAGTTCCATTCCCAAGACCCGCACAAGACAGAAAGGATGTGAAGACACTAATAGTGGAAATGCTTCAAGCTGCTAAGCCT
ATTCCCAATTAG