Details for Lyrate rockcress Locus 16038562

Position : sca3 ( 5`- 5825540 .. 5826737 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038562

Protein [Map View]
MSWAGPEDIYLSTSLASYLDRKLLVLLRDGRKLMGTLRSFDQFANAVLEGACERVIVGEQYCDIPLGLYVIRGENVVLIG
ELDTEREELPPNMIRVSEAEIKRAQKVEREASELRGTMRKRMEFLDFD*

DNA
ATGTCTTGGGCTGGTCCTGAAGATATTTATCTTTCAACCTCACTCGCTAGTTATCTCGATAGAAAACTACTTGTGCTCCT
TAGAGATGGTAGAAAGCTAATGGGAACACTCCGTTCCTTTGATCAATTCGCCAATGCGGTTCTAGAAGGTGCGTGTGAGA
GGGTAATTGTTGGTGAACAATACTGTGACATTCCTTTAGGCCTCTATGTAATCCGTGGAGAGAATGTTGTTTTGATTGGT
GAGCTGGACACGGAGAGAGAAGAGCTTCCGCCAAATATGATTCGCGTCTCAGAGGCAGAGATTAAAAGGGCCCAAAAGGT
GGAGAGAGAAGCGAGTGAGCTGAGAGGAACAATGAGGAAGAGAATGGAGTTTCTCGACTTTGATTAA