Details for Lyrate rockcress Locus 16038556

Position : sca3 ( 5`- 8493148 .. 8489820 -3` )
Annotation : [B2G] beta- -xylosidase
External links : CoGe
PGDD synteny : 16038556

Protein [Map View]
MSVGRFVGVSLLIAALVSSLCESQKNFACDRNDPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVSRLGV
PPYEWWSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNVGLAGLTYWSPNVNIFR
DPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVQDAGKSRRLKVSSCCKHYTAYDLDNWKGIDRFHFDAKVTKQDLEDTYQ
PPFKSCVEEGDVSSVMCSYNRVNGIPTCADPNLLRGVIRGQWRLDGYIVSDCDSIQVYFDDIHYTKTRLNMNCGDFLGKY
TENAVKLKKLNGSEVDEALIYNYIVLMRLGFFDGDPKSLPFGQLGPSDVCSKDHQMLALEAAKQGIVLLENRGDLPLSKT
AVKKIAVIGPNANATKVMISNYAGVPCKYTSPLQGLQKYVPEKVVYEPGCKDVNCGEQTLISAAVKAVSEADVTVLVVGL
DQTVEAEGLDRVNLTLPGYQEKLVRDVANAAKKTVVLVIMSAGPIDISFAKNLSTISAVLWVGYPGEAGGDAIAQVIFGD
YNPSGRLPETWYSQEFADKVAMTDMNMRPNSTSGFPGRSYRFYTGKPIYKFGYGLSYSAFSTFVLSAPSIIHIKTNPILN
LNKTTSIDISTVNCHDLKIRIVIGVKNRGQRSGSHVVLVFWKPPKCSKTLVGAGVPQTQLVGFERVEVGRSMTEKVTVEF
DVCKALSLVDTHGKRKLVTGHHTLVIGSNSDQQIYHHLNVRLAGDSTKQRSLMEGLIPYLIHAIKKDYKPDHQRYRSMSV
GSSRSYRPLMMGQEGSSSMQGSSHRRTRSDYNPPAIMDKSDQRSSGFGQEFVNKDSSSQNIATKT*

DNA
ATGAGTGTAGGAAGATTTGTGGGTGTCTCTCTGCTAATAGCAGCTCTAGTTTCATCACTATGCGAGTCTCAAAAGAACTT
TGCGTGTGACAGGAATGACCCTGCGACGGCTAAGTATGGTTTCTGCAACGTCTCGTTGTCGTATGAAGCCCGTGCCAAAG
ATTTGGTCTCACGTCTCTCCCTTAAGGAAAAGGTCCAGCAACTCGTAAACAAAGCCACGGGAGTTTCAAGGCTCGGTGTT
CCTCCGTACGAGTGGTGGTCAGAAGCTCTCCACGGCGTCTCCGACGTTGGACCAGGGGTGCGTTTCAACGGGACGGTGCC
TGGAGCGACGAGTTTCCCGGCGACGATATTAACGGCAGCGAGCTTTAACACATCGTTGTGGCTAAAAATGGGAGAAGTGG
TTTCTACGGAGGCTCGAGCGATGCACAACGTAGGACTAGCTGGACTCACCTATTGGAGTCCCAACGTTAACATATTTAGA
GATCCAAGGTGGGGTCGTGGCCAAGAGACGCCAGGGGAGGACCCTCTCGTTGTTTCAAAGTATGCCGTGAATTACGTCAA
GGGCTTACAAGACGTTCAGGACGCAGGAAAATCACGGCGGCTTAAGGTTTCGAGTTGTTGCAAGCATTACACTGCTTATG
ATCTTGATAACTGGAAAGGCATCGATAGATTCCACTTCGATGCCAAGGTAACGAAGCAAGACTTGGAAGACACGTATCAG
CCGCCATTCAAGAGCTGTGTAGAGGAAGGAGATGTGAGCAGTGTAATGTGTTCTTACAACAGAGTTAATGGTATCCCAAC
TTGTGCAGACCCTAATCTTCTTCGTGGAGTTATCCGAGGCCAATGGCGTCTTGACGGGTACATCGTTTCGGATTGTGATT
CTATCCAGGTCTATTTCGACGACATTCATTACACCAAGACACGTTTGAACATGAACTGTGGAGATTTTCTAGGTAAGTAC
ACAGAGAATGCAGTGAAGCTTAAGAAACTGAACGGATCAGAGGTTGATGAAGCGCTGATTTACAACTACATTGTTCTCAT
GAGGCTCGGATTCTTTGACGGAGATCCAAAATCACTTCCCTTTGGTCAACTTGGACCGTCTGATGTCTGCAGCAAGGACC
ATCAAATGCTTGCGCTAGAAGCAGCAAAACAGGGGATTGTACTGCTTGAGAACAGAGGAGATCTTCCGTTATCGAAGACC
GCGGTTAAGAAAATAGCAGTTATAGGGCCAAATGCAAATGCTACAAAGGTAATGATTAGTAACTATGCGGGTGTTCCTTG
TAAGTACACAAGCCCTTTACAAGGGCTGCAAAAGTATGTACCGGAAAAGGTTGTTTACGAACCGGGGTGTAAAGATGTCA
ACTGTGGTGAGCAAACACTAATTTCAGCAGCGGTCAAGGCGGTTTCAGAGGCTGATGTGACAGTTTTGGTGGTTGGATTG
GATCAGACGGTAGAGGCAGAGGGTCTTGACCGGGTTAACTTAACCCTTCCGGGTTACCAAGAAAAGCTGGTGAGAGATGT
GGCTAATGCTGCAAAAAAAACTGTTGTGTTGGTCATAATGTCAGCCGGACCTATAGATATCTCATTCGCCAAGAATCTGA
GCACGATTAGCGCGGTTTTATGGGTTGGATATCCTGGTGAAGCTGGAGGAGACGCTATAGCTCAAGTCATATTTGGTGAC
TACAATCCTTCTGGGAGACTACCAGAGACATGGTACTCACAAGAGTTTGCGGATAAGGTTGCAATGACGGACATGAACAT
GCGGCCTAACTCAACCTCTGGTTTTCCTGGAAGATCTTACAGATTCTACACAGGGAAACCGATTTACAAGTTCGGATACG
GGCTTAGCTACTCTGCTTTCTCGACTTTCGTTCTCTCAGCTCCATCGATCATACACATCAAAACCAATCCAATCTTGAAC
CTAAACAAAACAACCTCTATCGATATCTCCACCGTAAATTGCCACGATCTCAAGATCCGGATCGTTATCGGGGTCAAGAA
CCGCGGGCAACGGTCTGGAAGCCACGTGGTGCTCGTGTTCTGGAAACCGCCTAAGTGTTCAAAAACTCTGGTGGGTGCTG
GCGTGCCACAGACGCAATTGGTAGGATTTGAGAGAGTAGAAGTTGGGAGAAGCATGACAGAGAAAGTTACCGTTGAGTTT
GATGTCTGCAAAGCACTTAGCCTTGTGGATACTCACGGTAAAAGGAAACTAGTCACCGGACACCACACGCTTGTTATTGG
TTCTAACAGTGATCAACAAATCTATCATCATCTCAACGTTAGATTGGCCGGAGATTCAACGAAACAGAGAAGTTTAATGG
AGGGGTTAATTCCATATCTGATTCATGCTATCAAGAAAGACTATAAGCCTGATCATCAGAGGTATCGATCGATGTCTGTA
GGATCGAGCCGAAGCTATCGACCATTAATGATGGGACAAGAAGGTTCTTCTTCGATGCAGGGATCTTCTCACCGTCGAAC
TAGATCAGACTACAATCCACCTGCTATAATGGATAAGTCTGATCAGAGATCATCAGGTTTTGGTCAAGAATTTGTGAATA
AAGATTCTTCTTCTCAAAATATAGCAACAAAGACTTAG