Details for Lyrate rockcress Locus 16038555

Position : sca3 ( 5`- 8240145 .. 8239033 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318670 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038555

Protein [Map View]
MTERKRELEEEATSTSVLPLNKKTKLNDSDSSPDSHDVIVFAASSSSVASSAALASDECSVTTAKEENDQCSSISSGFFT
RIAKNSSSFGVDLETHEIKTETETSTFINNKFRKETSPVSEGLGETTTEMESSSATERKQPKVSKTPTPTEIEDFLSELE
NDNKKRFIEKYNFDIVNDEPLEGRYKWDRL*

DNA
ATGACCGAGAGAAAGCGAGAGCTTGAAGAAGAAGCTACAAGCACAAGCGTCTTACCTCTCAACAAAAAGACGAAGCTTAA
TGATTCTGATTCATCACCGGACTCTCATGACGTCATCGTCTTCGCGGCTTCTTCTTCTTCCGTTGCTTCGTCGGCGGCTT
TAGCTTCAGATGAATGTTCCGTTACTACCGCCAAAGAAGAAAACGATCAGTGCTCGAGTATCAGCTCCGGTTTTTTCACC
AGAATCGCGAAGAACAGTTCGTCGTTTGGTGTAGATCTGGAGACTCATGAAATCAAAACCGAAACCGAAACCTCAACATT
CATCAACAACAAATTCAGAAAAGAGACAAGTCCAGTGAGCGAAGGTTTGGGAGAAACAACAACAGAAATGGAATCATCGT
CGGCGACGGAGAGAAAACAACCGAAAGTGAGCAAGACTCCAACGCCGACGGAGATTGAGGATTTCTTATCGGAGCTAGAG
AACGATAATAAGAAGCGATTCATAGAAAAGTACAACTTCGATATTGTCAATGACGAACCGCTTGAAGGTCGCTACAAGTG
GGATCGACTTTAA