Details for Lyrate rockcress Locus 16038546

Position : sca3 ( 5`- 12756202 .. 12757662 -3` )
Annotation : [B2G] oxidative signal-inducible1
External links : CoGe
PGDD synteny : 16038546

Protein [Map View]
MREEDQKQSRALDFNRLEVLSLLGRGAKGVVFLVRDDDAKLLALKVILKEAIEKKKKKARESEEDEYKRVSFEQGVLSRF
DHPLFPSLHGVLATDKVIGYAIDYCPGQNLNSLRKMQSESMFSDDIIRFYAAELVLALEYLHNQGIVYRDLKPDNVMIQE
NGHLMLIDFDLSTNLAPRTPQPSPSPSKPSPATTRKKRLFRFSSFCNSGISPQESISIHSSSTLAVSDSSGEKSNSFVGT
EEYVAPEVITGDGHDFAVDWWSLGVVLYEMLYGTTPFRGSNRKETFYRILSKPPNLTGETTSLRDLIRRLLEKDPSRRIN
VEEIKGHDFFKGVDWEKVILVSRPPYIPAPDDGGDKGKDVNTKMDVENIVQEIFAAREERDKQSGDNNNANMRIKGDNSG
EWVKGLNNNNNHDLESENNFLVF*

DNA
ATGCGAGAGGAAGACCAGAAACAGAGCCGGGCTCTAGATTTTAATCGACTCGAGGTTTTGTCATTACTAGGTCGAGGAGC
TAAAGGAGTTGTGTTTCTTGTCCGCGACGACGACGCTAAGTTGCTTGCTTTAAAAGTTATACTTAAGGAAGCTATAGAGA
AGAAGAAAAAGAAGGCTAGAGAAAGTGAAGAAGATGAGTATAAACGCGTAAGTTTCGAGCAAGGCGTATTAAGCAGATTC
GACCATCCTCTCTTTCCGTCTCTTCACGGCGTTTTAGCTACCGATAAAGTCATCGGTTATGCCATCGATTATTGTCCGGG
ACAAAATCTCAATTCTTTGAGGAAAATGCAATCGGAAAGTATGTTTTCCGACGACATTATCAGATTTTACGCGGCGGAGC
TTGTACTAGCACTTGAATATTTGCATAATCAAGGAATTGTGTACAGAGATTTGAAGCCAGATAATGTGATGATCCAAGAA
AATGGACATTTAATGCTAATAGATTTCGATCTTTCTACAAATCTAGCTCCAAGAACACCGCAACCGTCGCCGTCACCGTC
TAAACCGTCGCCGGCAACGACGAGAAAGAAACGTCTCTTCCGCTTCTCCAGTTTTTGTAACTCAGGAATCTCGCCGCAAG
AATCGATCTCGATTCACTCATCATCTACATTAGCCGTGTCAGATTCATCAGGAGAAAAGTCGAATTCTTTCGTCGGAACA
GAGGAATACGTAGCGCCGGAGGTAATCACCGGAGACGGCCACGATTTCGCCGTCGATTGGTGGTCGTTAGGGGTTGTTCT
ATACGAGATGTTGTATGGAACGACGCCGTTTAGAGGATCGAACCGGAAAGAGACGTTTTACCGGATTTTATCTAAACCGC
CGAATCTTACCGGTGAAACGACGTCGTTGAGGGATTTGATTAGAAGATTGTTGGAGAAAGATCCTAGCCGTAGGATCAAC
GTTGAGGAAATTAAAGGTCACGATTTCTTCAAAGGAGTGGATTGGGAGAAGGTGATTTTGGTTTCTAGACCACCGTATAT
TCCGGCGCCGGACGACGGTGGTGATAAGGGTAAAGATGTAAATACGAAAATGGATGTGGAGAATATTGTCCAAGAGATTT
TTGCTGCAAGAGAAGAACGTGATAAACAGAGTGGTGATAATAATAATGCTAATATGAGAATTAAAGGTGATAATAGTGGG
GAATGGGTTAAGGGGTTGAATAATAATAATAATCACGATTTAGAAAGTGAAAACAATTTTTTGGTATTTTAA