Details for Lyrate rockcress Locus 16038506

Position : sca3 ( 5`- 2876749 .. 2870857 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038506

Protein [Map View]
MAYLSSSQSSFISCNENSSLDSILVSINDYILGVISDPEAWISLKQKCITLLSIEEDNTLFDDFSSEHSALSNLYWGIDS
IETSIHPECSEEKTSRLRNSERMLQMPALLDEQGTTTSGVPNTILVSFSYFYLSIVSYLQGDSLQSTLHFLQSVLVSPEI
VRSVIAPELCESIFFTPGVYKSDEEIREIARKYKYRATYYQVMSYGETHQPPRECTEKPLRSQKKYGQEIFTANAHSVAE
KLQLSETCEEDYNPELGKSTRVRCLNEFLNESQLDTREDVGTDTLANIFCVSQQQAHKEAYNEDTLANRSRSSIGNFNHS
IFDIQAQQSKTNLYTHLEDASSLRQLDLEEISVFGHKGSITFEGMRRNLQTKKRGNGHETHSRRASTMDLWKNLQSLIKE
VLGNADEKYVSEVTMIYQMLNRKEGFKYRMLKDVILDQLFTAISSSEEKTVIKASMTALTKIISVNRTALEEVKRKGLNL
SHLANALKQNVQEAAILIYLIKPSPTEIKSLELLPALVDVVASTSSSPSCYTFRPSPPLLTPPAASLMIIEVLITAFDHA
TNTMHLAAISSPSVLCGLLDVAKSGNSGEFISLARSISISILEWLVLRISCKAKTKKKCAFLFNFFMKSSAIKILQQIKK
EGSFDIKGDHKLFAVDILLQLNALDSPPENKKYRNEATRALLDAVTYSEGSNMQLLSTLILSNIGGTYSWTGEPYTAAWL
MKRGGLTSMSHMNMIRNINWSDECLQDPGIDGWCCKIARRIIDTGKATFCGLQEGLKSQNKSVSKACLIAIAWFSIEISK
GPNSLKYSACEVLLDEIAQFLHPGLELEERLLACICIYNFSSGKEMHQSGSGAVTALIYHKGLLFSGYSDGSIRVWNVNK
KLATILWDIKEHKSTVTCFSLSEAGESVLSGSADKTIRVWQIVKGKLECAEVIKKKDSIRKLEAFGSMIFVITKGHKMKL
LDSSRISQSIFKGKGVKSMVAAQGKIYIGCIDTSIQELIVTNKREKEIKAPTRSWRIQNKPINSVVVYKDMLYSSSTHVE
MSNIKDLRRNYEPQMSITAEKGSNIVAMGVVEDFIYLNRSSSANTLQHFSLYFSSWTPFDVLVPTISSTHY

DNA
ATGGCTTACCTTTCATCTTCTCAATCGAGTTTTATCTCATGTAATGAGAATTCATCTCTTGACTCGATTCTAGTTTCGAT
CAACGACTACATTCTTGGCGTGATATCAGACCCCGAAGCATGGATTTCGCTTAAGCAGAAATGCATCACATTGCTCAGCA
TTGAAGAAGATAATACTCTGTTTGATGATTTCTCTTCTGAACACTCTGCTCTCTCGAATCTCTATTGGGGAATCGATAGC
ATCGAAACGTCTATACACCCCGAATGCTCAGAAGAGAAGACGTCTCGTCTGAGAAACTCAGAGAGAATGCTTCAAATGCC
TGCGTTGCTTGACGAACAAGGGACCACCACTTCTGGTGTTCCAAACACAATCTTGGTTTCTTTCTCTTACTTTTACCTCT
CCATTGTAAGCTATCTCCAAGGTGATTCCTTGCAGTCCACATTGCATTTTCTCCAGTCGGTTTTGGTCTCGCCGGAGATT
GTAAGATCTGTCATTGCCCCTGAACTTTGCGAGAGCATTTTCTTCACTCCTGGTGTGTACAAGTCAGATGAAGAGATCAG
AGAGATTGCAAGAAAGTATAAATACAGAGCAACTTATTACCAGGTTATGTCCTATGGAGAGACTCATCAGCCGCCACGTG
AATGTACAGAGAAGCCGCTTAGAAGTCAGAAGAAATATGGGCAAGAAATATTTACGGCTAATGCACATTCAGTTGCAGAG
AAGCTACAGTTGTCAGAAACCTGTGAGGAAGATTACAATCCAGAGCTTGGAAAAAGTACAAGAGTCAGATGCCTTAATGA
ATTCTTGAACGAGTCTCAGCTAGATACTAGAGAAGACGTTGGCACGGACACATTAGCAAACATCTTCTGTGTTTCCCAAC
AACAAGCTCACAAGGAAGCATATAATGAGGACACATTAGCCAACAGATCCCGCAGTTCTATCGGTAATTTTAACCATTCC
ATCTTTGATATTCAGGCTCAACAATCAAAGACAAATTTGTATACCCACTTAGAAGATGCCTCTTCTTTGAGGCAACTAGA
TTTGGAAGAAATCTCAGTATTTGGACATAAAGGGTCCATAACTTTTGAAGGAATGAGGAGAAATTTGCAGACCAAAAAAC
GAGGAAATGGGCATGAAACGCATTCTAGAAGAGCTTCAACAATGGATTTATGGAAGAACCTTCAGAGCTTGATTAAGGAA
GTGTTAGGGAATGCAGATGAGAAATATGTCTCAGAGGTTACAATGATATATCAAATGCTGAATAGAAAAGAAGGATTCAA
ATATAGAATGCTAAAAGATGTCATACTGGATCAGCTGTTTACGGCTATTTCTAGTTCCGAGGAGAAAACCGTGATTAAAG
CATCGATGACCGCACTTACCAAGATCATATCAGTCAATAGAACAGCTCTCGAGGAGGTCAAGAGGAAAGGTTTAAATCTA
AGTCATTTAGCAAATGCTCTGAAACAAAATGTGCAAGAAGCAGCTATTCTCATTTACCTGATAAAGCCATCTCCAACAGA
AATAAAGAGTCTTGAGCTATTACCAGCTCTTGTAGATGTTGTTGCATCCACTTCTTCTTCCCCTTCTTGTTACACATTTA
GACCTTCACCTCCTCTTTTGACGCCGCCTGCGGCATCATTGATGATAATTGAAGTGCTTATTACTGCTTTTGATCATGCT
ACAAACACAATGCACTTGGCTGCAATCAGTTCTCCTTCTGTCCTTTGTGGACTTCTTGACGTTGCAAAGAGTGGAAACTC
AGGGGAATTCATCTCCTTGGCCAGAAGTATATCTATCAGCATACTCGAGTGGCTCGTTTTGCGCATCTCCTGCAAAGCAA
AGACCAAGAAGAAATGTGCATTTCTCTTCAATTTCTTCATGAAGTCGTCAGCTATTAAGATTCTGCAGCAGATAAAGAAA
GAAGGAAGTTTTGACATTAAGGGTGATCACAAACTCTTTGCAGTAGATATATTGCTTCAGTTGAATGCACTGGATTCCCC
ACCTGAGAACAAAAAGTACAGAAATGAAGCTACCAGAGCTCTACTTGATGCAGTTACATATAGTGAAGGTTCAAATATGC
AGCTTTTATCAACATTGATACTTTCGAATATTGGTGGAACTTATTCATGGACAGGAGAACCATACACTGCTGCTTGGCTA
ATGAAAAGAGGAGGTCTAACTTCTATGTCACATATGAATATGATAAGAAACATCAACTGGTCAGATGAATGCTTACAGGA
TCCAGGAATAGATGGATGGTGTTGTAAAATAGCAAGACGAATTATTGATACAGGCAAAGCCACGTTTTGTGGTTTACAAG
AAGGGCTAAAGAGTCAGAACAAGAGTGTTTCAAAAGCATGTCTTATAGCCATTGCATGGTTCAGTATAGAGATTTCAAAA
GGTCCAAATAGTTTAAAATACTCAGCATGTGAAGTCTTACTTGATGAGATAGCACAATTTCTACACCCTGGTTTGGAGCT
TGAAGAAAGACTTCTTGCTTGTATATGCATCTACAATTTTAGCTCTGGCAAAGAGATGCATCAATCTGGAAGTGGAGCTG
TAACAGCACTCATCTACCATAAAGGCTTGCTCTTTAGTGGATACTCAGATGGTTCAATCAGGGTGTGGAATGTGAATAAG
AAATTAGCTACAATTTTATGGGACATCAAGGAGCACAAAAGCACAGTAACATGCTTTTCACTCTCTGAAGCAGGGGAGAG
TGTCTTAAGTGGATCTGCAGATAAAACTATCAGGGTGTGGCAGATAGTTAAAGGAAAACTAGAATGTGCTGAAGTCATAA
AAAAAAAAGATTCAATAAGGAAACTGGAAGCATTCGGAAGTATGATCTTTGTAATAACCAAAGGGCACAAGATGAAGCTG
CTTGATTCATCGAGAATATCTCAAAGTATCTTCAAAGGTAAAGGTGTGAAGAGTATGGTAGCAGCTCAAGGAAAGATTTA
TATAGGATGCATAGATACAAGCATACAGGAATTAATTGTTACAAATAAACGGGAGAAAGAGATCAAAGCACCGACGAGGA
GCTGGAGAATTCAAAACAAGCCTATCAATTCAGTGGTTGTGTACAAAGATATGTTATATAGCTCAAGTACACATGTTGAG
ATGTCTAATATAAAGGATCTGAGAAGGAATTATGAGCCCCAAATGTCAATAACAGCAGAAAAGGGGTCTAATATAGTAGC
AATGGGTGTGGTTGAAGACTTCATCTACCTGAATCGAAGTTCATCCGCAAACACTCTTCAGCATTTTAGTCTTTATTTCA
GCTCATGGACCCCTTTTGATGTCCTTGTCCCGACCATCTCTTCCACACATTATAT