Details for Lyrate rockcress Locus 16038457

Position : sca3 ( 5`- 22258158 .. 22260279 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_343397 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038457

Protein [Map View]
MEEVWKEINNGSLHYHRQLNIGHEPMLKNQNPNNSTFQDFLNMPLNQQPPSTSSIVTALYGSLPLPPPATVLSLNSGVGF
EFLDTTETLAASNPHSFEESARVGCLGKKRSQDPDESRGDRRYKRMIKNRESAARSRARKQECAYTNELELEIAHLQTEN
ARLKIQQDQTSSSSSQLISALFVGEMTESKVVVPDVCDGYSISASTPSMSNVGQVSSFNQHLSVCV*

DNA
ATGGAAGAAGTATGGAAAGAAATCAACAATGGTTCACTTCACTACCATCGCCAACTAAACATTGGTCATGAACCAATGTT
AAAGAACCAAAACCCTAATAACTCCACCTTTCAAGATTTCCTCAACATGCCTCTGAATCAACAACCACCTTCTACTTCCT
CCATTGTCACTGCTCTCTATGGCTCTCTGCCTCTTCCTCCTCCTGCCACTGTCCTCAGCTTGAACTCCGGCGTTGGATTC
GAGTTTCTTGATACCACAGAAACTCTTGCTGCTTCTAACCCTCACTCCTTTGAGGAATCTGCAAGAGTTGGTTGTCTTGG
TAAGAAAAGAAGCCAAGATCCTGATGAAAGTAGAGGAGACAGAAGGTATAAGCGAATGATCAAGAACAGAGAATCTGCTG
CTCGTTCAAGGGCTAGGAAACAGGAATGTGCATACACAAACGAACTTGAGCTTGAAATTGCTCACTTGCAGACAGAGAAT
GCAAGACTCAAGATACAACAAGACCAGACTTCTTCTTCTTCATCTCAACTTATTTCTGCTTTGTTTGTAGGAGAAATGAC
TGAATCCAAGGTAGTGGTTCCAGATGTCTGTGATGGATACTCAATATCTGCTTCAACACCATCAATGTCCAATGTTGGGC
AAGTTTCTTCTTTCAACCAACACCTCTCTGTGTGTGTATAG