Details for Lyrate rockcress Locus 16038402

Position : sca3 ( 5`- 9367713 .. 9369575 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898561 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038402

Protein [Map View]
MQLQTQSFALNLLPSQNFAKPIERREFISLKRDPSRPISLRCSVSTALDTPATASTHKPFPAEVSRSIMELSSVGTLSTL
THDGWPLGVGVRFAVDKDGTPVLCLNRSFSPDKRSALHVQLEQCGLRTPQCTIQGSIGRPGDDTVLKRLSATWREKFGEE
VEEDSLYVVAVDRVLQMEDFMEDGIWVASSDYKNASPDPLRDVAEDIVNNINTNNMEDIFRFCNVYVDLDFVVSETKMIW
MDRLGFDLRVWSPRGVYDVRIPFPMEVTDEKGAKSSFNGMSQLAWEVEKSYCPADFNKVKLFKQVVGSSHKGRQ*

DNA
ATGCAACTCCAAACCCAATCCTTCGCTCTCAATCTTCTCCCATCTCAGAATTTCGCCAAACCCATCGAAAGACGTGAATT
CATCTCTCTAAAACGAGACCCATCTCGTCCAATTTCTCTCCGATGTTCCGTTTCCACGGCTTTGGATACTCCGGCGACCG
CTTCGACCCACAAGCCCTTTCCGGCGGAGGTTTCAAGGAGTATCATGGAGCTTTCCTCCGTTGGAACTCTCTCCACTTTG
ACCCACGACGGCTGGCCTCTCGGCGTAGGAGTTCGCTTCGCCGTTGACAAAGATGGCACTCCTGTTCTATGCCTCAATCG
CTCTTTCTCTCCTGACAAGAGGTCTGCTCTTCATGTTCAGTTAGAACAATGTGGATTAAGGACTCCTCAGTGTACGATAC
AAGGTAGCATTGGTCGACCTGGAGACGATACTGTTCTAAAGCGTCTTAGTGCTACATGGAGGGAAAAGTTTGGCGAAGAA
GTTGAGGAAGACAGTTTATATGTTGTTGCAGTTGACCGTGTTCTCCAAATGGAAGATTTCATGGAGGACGGAATCTGGGT
GGCGTCATCAGATTATAAAAATGCAAGTCCTGACCCTCTCAGAGATGTTGCAGAAGACATTGTCAACAATATTAACACTA
ACAACATGGAAGACATTTTCCGTTTCTGCAACGTATACGTGGATCTAGACTTTGTGGTTTCGGAAACAAAGATGATATGG
ATGGATAGGCTTGGATTTGACCTCCGAGTATGGTCTCCACGAGGTGTATATGATGTGAGGATTCCATTTCCAATGGAAGT
AACAGATGAGAAGGGAGCAAAATCATCCTTCAATGGGATGTCACAGCTTGCTTGGGAAGTAGAGAAAAGCTATTGTCCTG
CAGATTTCAACAAGGTCAAACTATTTAAGCAAGTTGTGGGATCATCACACAAGGGACGACAATAA