Details for Lyrate rockcress Locus 16038380

Position : sca3 ( 5`- 2238498 .. 2237785 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038380

Protein [Map View]
QKFRERIEPNKLKIPKRVLQVIDEELTKLEVFKTGNDFTIASNYLEWLTVFPWGNYSGENCDVMSAEKILDEDHYGLSNV
KERIIEHIAVEKLRGTPQGKIICLAGPPGVGKTSIARSIARSLHRNFFQFSVGGLCTAANIKGIPRTFYYATLGKMVQCL
KIKCGNREITKRIFVGFI*

DNA
CAAAAGTTTAGGGAAAGGATTGAGCCTAATAAGCTAAAAATCCCAAAACGTGTATTGCAAGTTATTGATGAAGAGCTTAC
GAAATTGGAGGTGTTTAAGACCGGTAACGACTTTACTATCGCCAGTAACTACCTTGAGTGGTTGACCGTATTTCCCTGGG
GAAATTACAGTGGTGAGAATTGTGATGTCATGAGTGCAGAAAAGATTCTTGACGAGGATCATTATGGCTTATCTAATGTA
AAAGAAAGAATAATAGAACACATTGCTGTTGAAAAACTTAGAGGCACTCCTCAAGGGAAGATAATTTGTCTAGCGGGTCC
TCCCGGGGTTGGTAAGACTAGCATTGCTCGTTCTATTGCACGTTCTCTTCACCGCAATTTCTTTCAATTCTCTGTTGGAG
GGCTATGTACGGCTGCTAACATTAAGGGGATTCCTCGAACATTTTACTATGCCACACTGGGAAAGATGGTGCAATGTCTA
AAAATTAAGTGTGGGAACAGAGAAATCACAAAACGTATTTTCGTTGGATTTATTTAA