Details for Lyrate rockcress Locus 16038373

Position : sca3 ( 5`- 8931634 .. 8938898 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479572 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038373

Protein [Map View]
MEEMEDAETEPQVYMACIQHGRRVGVSYYDCSVRQLHVLEVWEEDCSDFTLINMVKYQAKPSIIYTSTKSEESFVAALQQ
NDGTDETTMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMMDVGSEVQVRVSGGLLAILESERIVETLE
QNESGSASIAIDSVMEVPLNKFLKLDAAAHEALQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPI
LDLEVLDRRLNAISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLHVNKIFEVGVSESL
REHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGFCAELDELRQIYEELPEFLQEVSAMELEH
FPHLHKEKLPPCIVYIQQIGYLMCIFGEKLDETTLNRLTEFEFAFSDMDGETQRFFYHTPKTRELDNLLGDIYHKILDME
RAIIRDLLSHTLLFSAHLLKAVNFVAELDCILSLACVAHQNNYVRPVLTIESLLDIRNGRHVLQEMAVDTFIPNDTEIND
NGRIHIITGPNYSGKSIYVKQVALIVFLSHIGSFVPADAATVGLTDRIFCAMGSKFMTAEQSTFMIDLHQVGMMLRQATS
RSLCLLDEFGKGTLTEDGIGLLGGTISHFVTCTEPPRVLVCTHLTELLNESCLPVSEKIKFYTMSVLRPDTESAKMEEIV
FLYRLIPGQTLLSYGEHLCVCVGVPEEVVKRAAIVLDAFESNNNVDKLSLDKISSQDQAFKDAVDKFMEFDIGKGDIRGF
FQDIFTS*

DNA
ATGGAGGAAATGGAAGACGCAGAAACCGAACCACAGGTTTATATGGCTTGTATTCAGCATGGTCGGAGAGTTGGAGTTTC
TTACTACGACTGTAGTGTACGCCAGCTTCATGTGCTAGAAGTTTGGGAGGAAGATTGCTCAGATTTTACCTTGATTAATA
TGGTAAAATATCAAGCGAAGCCATCGATCATTTACACAAGCACTAAAAGTGAAGAATCCTTTGTAGCTGCTCTGCAGCAA
AATGACGGAACTGACGAGACTACCATGGTGAAGCTGGTCAAGAGCTCAACATTCAGCTACGAGCAAGCGTGGCACAGACT
GGTATATCTTCGAGTAACAGGAATGGATGATGGGTTGAACATCAAAGAAAGGATTTGTTATCTGAGTTCCATGATGGATG
TGGGCAGTGAAGTCCAAGTTCGTGTCAGTGGGGGCCTTCTTGCTATATTAGAAAGTGAACGAATTGTAGAAACCCTGGAA
CAAAACGAATCTGGGAGTGCGTCAATTGCAATTGATTCAGTCATGGAAGTACCATTGAACAAGTTTCTTAAACTTGATGC
GGCTGCTCACGAGGCTCTGCAGATATTTCAAACAGATAAACATCCAAGCCATATGGGCATTGGCCGGGCCAAAGAAGGGT
TCTCGGTGTTTGGAATGATGAATAAGTGTGCCACACCAATGGGTAGACGCCTTTTAAGAAGCTGGTTTATGAGACCAATT
TTAGATCTTGAAGTGTTAGATCGCCGTCTCAATGCTATTTCCTTTTTCATTTCTTCAGTAGAGCTGATGGCATCATTGCG
GGAGACACTGAAATCAGTGAAGGACATTTCGCATCTGCTCAAGAAATTCAACTCTCCGACGTCCCTCTGTACCAGTAACG
ACTGGACAGCTTTTTTGAAGAGTATAAGTGCGCTCCTGCACGTGAATAAGATATTTGAAGTTGGAGTTTCAGAAAGTCTC
AGAGAACATATGAGACGCTTCAACTTGGACATTATTGAGAAGGCCGGCTTATGTATCAGCACAGAGCTAGATTATGTCTA
TGAACTGGTCATTGGAGTCATTGATGTTACTAGAAGCAAAGAGAGGGGATATCAAACATTGGTGAAAGAAGGATTCTGTG
CTGAGTTGGATGAGCTGAGGCAAATATACGAGGAGTTGCCAGAGTTTCTGCAGGAGGTTTCAGCGATGGAGTTAGAACAC
TTTCCTCATTTGCATAAGGAAAAGCTTCCTCCTTGTATCGTCTATATTCAACAAATTGGGTACCTCATGTGTATCTTTGG
AGAAAAGCTTGATGAAACTACACTTAATAGGCTTACTGAATTTGAATTTGCGTTTTCCGATATGGATGGAGAGACTCAGC
GATTCTTTTACCATACGCCGAAGACACGAGAGTTAGACAACCTTCTTGGAGATATCTATCACAAAATTTTAGATATGGAA
AGGGCAATTATTAGGGACTTGCTATCACACACGCTTTTGTTCTCGGCTCACCTGCTGAAGGCAGTTAACTTTGTTGCAGA
ACTTGATTGCATTTTATCGTTGGCTTGTGTAGCCCATCAGAACAACTACGTAAGGCCTGTCCTGACAATAGAATCATTGC
TTGATATTCGAAATGGAAGGCATGTTTTGCAGGAAATGGCTGTGGATACTTTTATCCCAAACGACACTGAAATCAATGAT
AATGGCCGAATTCATATAATTACCGGGCCTAATTACTCAGGAAAGAGCATATATGTAAAGCAGGTGGCTTTAATTGTTTT
CCTATCCCATATTGGAAGCTTTGTACCAGCAGATGCAGCAACTGTTGGTTTAACTGACAGGATCTTTTGTGCAATGGGAA
GCAAGTTCATGACCGCGGAGCAATCTACATTCATGATAGATCTGCATCAAGTAGGAATGATGCTCAGACAGGCAACTTCA
AGATCTCTGTGTCTCTTAGACGAGTTTGGTAAAGGCACTCTTACAGAAGATGGTATTGGCTTGCTTGGTGGGACAATTAG
TCACTTTGTTACATGTACTGAGCCACCAAGGGTTCTAGTGTGTACGCACTTGACTGAACTACTTAACGAGAGCTGCTTGC
CTGTTTCTGAGAAGATTAAATTCTATACAATGAGCGTTCTTAGGCCAGACACAGAATCTGCAAAAATGGAAGAAATTGTT
TTTCTTTATCGGTTAATTCCGGGACAAACTTTACTGAGCTATGGTGAGCATCTTTGTGTTTGCGTTGGTGTCCCGGAGGA
AGTCGTGAAGAGAGCAGCCATCGTGTTGGACGCCTTTGAGAGTAACAACAACGTCGATAAACTAAGCCTTGACAAAATAT
CGTCTCAAGATCAAGCATTCAAGGATGCTGTTGACAAGTTTATGGAGTTTGACATCGGTAAAGGTGACATCCGTGGCTTC
TTTCAAGATATCTTCACTTCCTAA