Details for Lyrate rockcress Locus 16038353

Position : sca3 ( 5`- 12203778 .. 12204842 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038353

Protein [Map View]
MAGVKRKLSTESDVHALHKELDEVSCPVCMDHPHNAVLLLCSSHDKGCRSYICDTSYRHSNCLDRFKKLHSESPNDPTPE
GNLASRENNNESLNEHGTASRSSFHRESTNRGSAWDSESLRRRRRVDEEEQSEDITNLKCPLCRGTVLGWKVVEEVRTYL
DLKNRSCSRESCSFTGNYQDLRRHARRTHPTTRPSDTDPSRERAWRHLENQREYGDIVSAIRSAMPGAVVVGDYVIENGD
RFSGERETGNGGSDLWTTLVLFQMIGSLDNGGSSASGSGGGSRSHRSRAWRNHRRSSSDRRYLWGENLLGLQEEHNNNDD
EELHMQNDAGGASTPVPRRRRRFGRPRSSGNHPR*

DNA
ATGGCTGGTGTAAAGCGAAAATTAAGTACCGAGTCAGATGTTCATGCTCTTCACAAAGAACTGGATGAGGTTTCATGTCC
TGTTTGCATGGATCACCCACATAATGCTGTTCTACTGCTGTGCAGCTCTCATGACAAAGGTTGCAGGTCCTACATCTGCG
ATACCAGTTACCGACATTCCAATTGCCTCGACCGGTTTAAGAAATTGCATTCTGAATCCCCAAATGACCCTACTCCCGAG
GGGAACTTGGCTTCAAGGGAAAATAATAACGAATCTCTAAACGAGCATGGTACAGCCAGTCGAAGCAGTTTTCACCGTGA
GTCTACAAACCGAGGCTCTGCTTGGGATTCCGAATCACTGAGGAGGAGGAGGAGAGTGGATGAAGAAGAGCAGTCAGAAG
ATATCACAAATTTGAAATGTCCTCTTTGCCGGGGTACTGTTTTAGGATGGAAGGTTGTAGAAGAAGTAAGAACATATCTT
GATCTTAAGAACCGAAGTTGCTCCCGAGAATCCTGTTCATTTACTGGAAACTACCAGGATCTGCGCCGTCATGCCAGAAG
GACACACCCAACAACTCGTCCTTCTGATACTGATCCATCAAGAGAGAGAGCTTGGAGGCATCTTGAGAACCAGAGGGAGT
ATGGAGATATAGTCAGTGCAATCCGTTCTGCCATGCCCGGTGCTGTTGTAGTAGGGGACTATGTTATAGAAAACGGAGAT
AGGTTCTCAGGTGAGAGGGAAACGGGAAATGGTGGGAGCGACCTTTGGACCACTTTAGTATTGTTTCAGATGATTGGTTC
TCTTGACAATGGAGGTTCTAGCGCTAGTGGCAGTGGTGGCGGTTCAAGATCCCACAGGTCAAGGGCATGGAGGAATCATC
GACGTTCGTCTTCAGATAGACGATATCTTTGGGGGGAGAATCTATTAGGTCTACAAGAAGAACACAATAACAACGATGAT
GAAGAGTTGCATATGCAGAACGATGCAGGCGGTGCTTCTACTCCTGTTCCAAGAAGAAGACGGAGATTCGGACGTCCTAG
ATCAAGCGGAAATCATCCGCGATAA