Details for Lyrate rockcress Locus 16038350

Position : sca3 ( 5`- 1326261 .. 1327553 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038350

Protein [Map View]
MFDERGSFSIAHPYPGPLAALFKSIGKLPDRVAFTGEIVPVKEKRVDAVNKYVEEAIQFEMRAISESPNSVRSILNSSDR
MYASRCDSLRALIDDAKEKYVIYKFVPSSCMFIDPNGAKEIDLKVLELSKADPLGTWSTKLVDGINKNESRRRALILFCL
YYLDINARDAYMVSVDKKGFHLLGKVPSEEEAGDEYQWREFRFEFEEEVKDVEAFCHQLVEMEQEVVSKFTDHTGL*

DNA
ATGTTTGATGAACGTGGATCCTTTTCTATTGCCCATCCATATCCTGGTCCCCTTGCAGCTTTGTTCAAGTCAATAGGAAA
GCTTCCAGACCGGGTTGCTTTTACTGGTGAGATTGTCCCTGTTAAAGAGAAAAGGGTTGATGCGGTGAATAAATATGTCG
AGGAAGCTATACAATTTGAGATGAGGGCGATTAGCGAGAGCCCAAATTCTGTTCGTAGTATCTTGAATTCTTCCGATCGG
ATGTATGCCTCCCGGTGTGACAGTCTTAGAGCCCTGATCGATGATGCAAAGGAAAAATACGTTATCTATAAGTTCGTTCC
AAGCTCATGTATGTTTATTGACCCAAATGGTGCGAAAGAGATAGACTTGAAGGTTTTGGAACTGTCGAAAGCAGATCCAT
TAGGGACTTGGTCTACAAAACTTGTGGATGGAATCAATAAGAACGAATCAAGAAGACGGGCTTTGATTCTTTTCTGTTTA
TACTATCTTGATATAAACGCAAGGGATGCTTATATGGTATCAGTGGATAAGAAAGGTTTCCACTTGTTGGGGAAGGTACC
GAGTGAAGAAGAAGCCGGAGATGAGTATCAGTGGAGAGAGTTTAGGTTTGAGTTTGAAGAAGAGGTGAAAGACGTTGAAG
CTTTTTGCCACCAACTTGTGGAAATGGAACAAGAGGTTGTAAGCAAGTTTACTGACCATACCGGTTTGTGA