Details for Lyrate rockcress Locus 16038345

Position : sca3 ( 5`- 5484130 .. 5484443 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038345

Protein [Map View]
MATVANVSTDKWQRMRRIPSSEILNTQQLVEVACCLPLSHLFICLWEFLCFSISDYDSDDDYDDDDVDDDDVLAFDHNSN
GDYDDHGSSSSSNLDFDDYYHYPD

DNA
ATGGCGACGGTGGCGAACGTATCCACCGACAAGTGGCAGCGGATGAGGAGGATTCCGTCGTCGGAGATATTGAATACTCA
ACAGCTTGTGGAGGTGGCTTGTTGCCTCCCTCTTAGTCATCTCTTCATCTGTCTTTGGGAGTTTCTGTGTTTCTCCATAT
CCGATTATGATTCTGATGATGATTATGATGATGATGATGTTGATGATGACGATGTGCTTGCTTTTGATCATAATAGTAAC
GGCGATTATGATGATCATGGGTCTTCTTCATCATCTAACTTGGATTTTGATGACTATTACCATTACCCGGACTC