Details for Lyrate rockcress Locus 16038341

Position : sca3 ( 5`- 5109498 .. 5107334 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038341

Protein [Map View]
MSEASCLASPFLYTNSGIHSDSFYASLIDSSTHKAQLRQIHARLLVLGLQFSGFLITKLIHASSSYGDITFARQVFDDLP
RPQVFPWNAIIRGYSRNNHFQDALLMYSKMQLARVSPDSFTFPHLLKACGGLSHLQMGRFVHAQVFRLGFEADVFVQNGL
IALYAKCRRLGCARTVFEGLPLPERTIVSWTAIVSAYAQNGEPVEALEIFSQMRKMDVKPDCVALVSVLNAFTCLQDLEQ
GRSIHASVMKMGLETEPDLLISLNTMYAKCGQVATAKILFDKMKSPNLILWNAMISGYAKNGFAKDAIDLFHEMINKDVR
PDTISITSAISACAQVGSLEQARWMDEYVSRSDYRDDVFISSALIDMFAKCGSVECARSVFDRTLDRDVVVWSAMIVGYG
LHGQAREAISLYRAMERDGVHPNDVTFLGLLIACNHSGMVREGWWFFNRMADHKINPQQQHYACIIDLLGRAGHLDQAYE
VIKCMPVQPGVTVWGALLSACKKHRHVELGKYAAQQLFSIDPSNTGHYVQLSNLYAAARLWDRVAEVRVRMKEKGLNKDV
GCSWVEVRGRLEGFRVGDKSHPRYEEIERQVEWIESRLKEGGFVANKDASLHDLNDEEAEETLCSHSERITIAYGLISTP
QGTTLRITKNLRACVNCHAATKLISKLVGREIVVRDTNRFHHFKDGVCSCGDYW*

DNA
ATGTCGGAAGCATCTTGTCTTGCTTCTCCTTTTCTCTACACCAATTCTGGAATCCATTCTGATTCTTTCTACGCTTCGCT
GATTGATAGTTCCACTCATAAAGCTCAGTTGAGGCAAATTCACGCACGTTTATTGGTTCTGGGTTTGCAGTTCAGTGGTT
TCTTGATCACCAAGCTCATTCACGCTAGCTCTTCCTATGGTGACATTACTTTTGCACGCCAGGTGTTCGACGATTTACCT
CGTCCTCAAGTATTCCCCTGGAATGCTATTATCAGGGGTTATTCGAGAAACAATCACTTCCAAGATGCTCTTCTTATGTA
TTCCAAGATGCAACTCGCTCGTGTTTCTCCTGATTCTTTCACTTTCCCTCATCTTCTTAAAGCTTGCGGCGGTTTGTCTC
ACCTTCAGATGGGTAGATTTGTTCATGCTCAGGTGTTCAGGCTTGGATTTGAAGCGGATGTGTTTGTTCAGAATGGTCTC
ATTGCCTTGTATGCGAAATGTAGGCGTTTGGGATGTGCGAGAACTGTATTTGAAGGACTGCCATTGCCAGAGAGGACGAT
TGTCTCATGGACGGCTATCGTTTCTGCTTATGCTCAGAACGGTGAGCCTGTGGAGGCTCTTGAGATTTTCAGTCAGATGA
GGAAGATGGATGTGAAGCCTGACTGTGTAGCTCTTGTCAGCGTTCTCAATGCTTTCACTTGCTTGCAGGATTTGGAGCAA
GGGAGATCTATTCATGCTTCTGTTATGAAGATGGGTCTTGAAACAGAGCCTGACTTGCTCATCTCTCTCAACACCATGTA
TGCAAAATGTGGCCAAGTAGCAACCGCCAAGATTCTGTTTGATAAGATGAAGTCACCTAACCTGATTTTGTGGAACGCCA
TGATCTCTGGCTATGCGAAGAACGGTTTTGCCAAGGATGCTATTGATTTGTTTCATGAGATGATCAATAAAGATGTCAGA
CCTGACACCATCTCTATAACATCTGCCATTTCAGCTTGCGCTCAAGTAGGTTCTCTTGAGCAGGCCCGCTGGATGGATGA
ATATGTAAGCAGGAGTGACTACAGGGATGACGTTTTCATAAGCAGCGCTTTAATCGATATGTTTGCTAAATGCGGAAGTG
TAGAGTGCGCAAGATCAGTTTTTGACCGAACACTTGACAGGGATGTTGTGGTGTGGAGTGCTATGATTGTCGGGTATGGA
TTGCACGGGCAGGCAAGAGAAGCAATCAGTCTGTACCGTGCAATGGAGCGTGATGGAGTACATCCCAATGACGTCACTTT
TCTGGGGCTTCTCATAGCCTGTAACCATTCAGGCATGGTAAGAGAAGGCTGGTGGTTTTTCAACCGGATGGCGGATCACA
AAATAAATCCGCAACAGCAACACTATGCATGCATCATTGATCTACTTGGTCGTGCTGGTCATCTAGATCAAGCTTATGAA
GTGATCAAATGCATGCCGGTCCAGCCCGGTGTAACGGTTTGGGGAGCACTTCTAAGCGCTTGCAAAAAGCATCGCCACGT
TGAACTGGGAAAATACGCAGCTCAGCAGCTATTCTCAATAGACCCATCCAACACAGGCCACTATGTGCAGCTCTCTAATC
TGTATGCTGCAGCGCGTTTGTGGGACCGTGTTGCAGAGGTGCGAGTGAGGATGAAGGAGAAAGGATTGAACAAAGACGTT
GGATGTAGCTGGGTTGAAGTAAGGGGAAGGTTGGAGGGTTTCAGAGTGGGTGATAAATCACATCCAAGATACGAAGAGAT
AGAGAGACAAGTAGAGTGGATAGAGAGTAGACTGAAGGAAGGTGGATTTGTGGCTAACAAGGATGCTTCATTGCACGATC
TCAACGATGAAGAAGCTGAAGAGACTCTGTGCAGCCACAGCGAGAGGATCACAATTGCATATGGGCTTATAAGTACACCC
CAAGGGACAACACTGCGGATCACAAAGAATCTGAGAGCATGCGTGAACTGTCATGCCGCTACAAAGCTTATCTCGAAGCT
TGTGGGCAGAGAGATTGTTGTGAGAGACACAAATAGGTTCCACCATTTTAAGGATGGAGTTTGTTCGTGTGGTGATTATT
GGTAA