Details for Lyrate rockcress Locus 16038308

Position : sca3 ( 5`- 3915675 .. 3914522 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478315 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038308

Protein [Map View]
MGSSSGQSGYDLSFKILLIGDSGVGKSSLLLSFISSSVEDLAPTIGVDFKIKQMKVRGKRLKLTIWDTAGQEKFRTLTSS
YFRGSQGIILVYDVTKRETFMNLADVWAKEIELYSTNHDCIKMLVGNKVDRESERKVSQEEGMALAKDLKCLFHECSART
RDNVNWCFEELALKIMEVPSLLEEGSSSVKRKPDYRSHQGRCCSS*

DNA
ATGGGATCTTCTTCTGGGCAAAGTGGTTATGATCTGTCTTTCAAGATCTTGTTGATTGGAGATTCTGGTGTTGGTAAAAG
TAGTTTACTTCTCAGCTTCATTTCTAGCTCTGTCGAAGATCTTGCTCCCACCATCGGTGTTGATTTTAAGATCAAACAGA
TGAAAGTGAGAGGGAAAAGACTCAAACTTACAATCTGGGACACAGCTGGACAAGAAAAGTTCAGGACATTGACAAGTTCT
TATTTCAGAGGCTCCCAAGGAATCATTCTCGTTTATGATGTGACGAAAAGAGAGACATTTATGAACTTAGCAGATGTTTG
GGCTAAAGAGATTGAGCTATATTCGACTAACCATGACTGCATTAAGATGCTTGTTGGCAACAAAGTTGATAGAGAATCTG
AGAGGAAGGTTAGCCAGGAAGAAGGAATGGCTCTAGCGAAAGACCTCAAGTGTTTGTTTCATGAATGTAGCGCAAGAACC
AGAGACAACGTGAACTGGTGCTTCGAAGAGCTTGCTTTGAAGATAATGGAGGTACCTAGTCTTTTGGAAGAAGGATCAAG
CTCTGTGAAGAGAAAACCGGATTACCGATCTCATCAAGGCCGGTGTTGCAGCTCGTGA