Details for Lyrate rockcress Locus 16038275

Position : sca3 ( 5`- 2261751 .. 2263583 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038275

Protein [Map View]
MSCPEKTTVDPLLRDLDEKKESFRRNVVSLAAELKQVRGRLVIQEQSFLKETITRKEAEKRGKNMEMEMCKLQKRLEERN
CQLEASASAADKVILTEFIILFLRTQFIKELEEFRSKLDATKQTAEASADSAQSTQIQCSLLKKQLDDKTRSLREHEDRV
TQLGHQLDDLQRGLSLRECSEKQLREEVKRIEREITESITKAGIDGMDCELQKLLEDVSPMKFERMNRLVEVKDEEITKL
KDEIRLMSGHWKHKTKELESQLEKQRRTDQDLKKKVLKLEFCLQEARSQTRKLQRKGERRDMEIKEIRDLISDKQQLNNE
SWDKQKFWDNSGFKIVVSMSMLMLVVVSKR*

DNA
ATGTCTTGTCCTGAAAAAACGACGGTGGATCCACTTCTGAGAGATTTGGATGAGAAGAAAGAGAGTTTCCGGCGAAACGT
GGTGTCTTTGGCGGCGGAGCTGAAGCAAGTGAGGGGCCGTTTGGTTATTCAAGAACAATCCTTTCTTAAAGAAACCATAA
CTAGAAAAGAAGCAGAGAAAAGGGGAAAGAATATGGAAATGGAGATGTGTAAATTGCAGAAGAGATTGGAAGAAAGGAAT
TGTCAGCTTGAAGCTTCTGCATCTGCTGCTGATAAGGTTATTCTTACTGAATTTATAATCTTGTTTTTGAGAACACAGTT
TATCAAAGAGTTGGAGGAATTTAGATCAAAGCTTGATGCAACCAAGCAAACCGCAGAGGCAAGTGCTGATTCTGCTCAAT
CTACACAGATCCAATGCTCACTGCTAAAGAAACAACTTGACGACAAAACACGTTCTCTTAGAGAACACGAAGACCGTGTG
ACTCAGCTCGGTCATCAGCTTGATGATCTACAGAGAGGTCTGAGCCTGAGAGAGTGCTCAGAAAAGCAGCTCAGAGAAGA
AGTTAAGAGAATCGAGCGGGAGATAACAGAGTCCATTACGAAAGCTGGGATAGATGGCATGGACTGCGAGCTCCAGAAAC
TTCTAGAAGATGTCTCTCCAATGAAATTTGAGAGGATGAATAGGCTAGTTGAAGTAAAAGACGAAGAGATTACAAAACTG
AAAGATGAGATAAGGTTAATGTCTGGTCACTGGAAACACAAGACTAAGGAACTCGAATCTCAGCTGGAGAAACAGAGAAG
AACTGATCAAGATTTGAAGAAGAAGGTACTGAAACTAGAGTTCTGTCTACAAGAAGCTAGAAGCCAGACAAGAAAGCTGC
AGAGGAAAGGGGAAAGAAGGGACATGGAGATCAAAGAGATAAGAGATCTGATATCGGACAAACAACAGCTTAACAATGAG
TCTTGGGATAAACAGAAGTTCTGGGACAATTCAGGGTTCAAGATCGTTGTGTCAATGTCTATGTTGATGTTAGTGGTAGT
CTCCAAGAGATGA