Details for Lyrate rockcress Locus 16038264

Position : sca3 ( 5`- 7695796 .. 7695060 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479290 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038264

Protein [Map View]
MENGKRDRQEMEVNTTPRKPRVLLAASGSVAAIKFGNLCHCFTEWAEVRAVVSKSSLHFLDKLSLPQEVTLYTDEDEWSS
WNKIGDPVLHIELRRWADVLVIAPLSANTLGKIAGGLCDNLLTCIIRAWDYSKPLFVAPAMNTLMWNNPFTERHLLSLDE
LGITLIPPIKKRLACGDYGNGAMAEPSLIYSTVRLFWESQAHQQSGGTS*

DNA
ATGGAGAATGGGAAAAGAGACAGACAAGAGATGGAAGTCAATACCACACCGAGAAAGCCTCGTGTACTACTGGCTGCAAG
TGGAAGTGTCGCTGCTATCAAATTCGGCAATCTCTGTCATTGTTTCACCGAATGGGCAGAAGTGAGAGCCGTAGTTTCGA
AATCATCTCTTCATTTCCTCGATAAACTCTCTCTCCCACAAGAAGTGACTCTGTATACTGATGAAGATGAATGGTCAAGC
TGGAACAAGATCGGTGATCCTGTCCTTCACATCGAGCTTAGACGTTGGGCTGATGTTTTAGTCATTGCTCCTTTGTCTGC
TAACACTCTAGGCAAGATTGCTGGTGGGCTTTGTGATAATCTTCTGACTTGCATTATACGAGCTTGGGACTATAGCAAAC
CACTGTTTGTTGCACCAGCTATGAATACTTTGATGTGGAACAATCCTTTCACTGAAAGGCATCTTTTGTCGCTTGATGAA
CTGGGAATCACACTTATTCCTCCTATCAAGAAGAGATTGGCCTGTGGAGACTATGGTAATGGCGCTATGGCTGAGCCCTC
TCTTATCTATTCCACTGTCAGACTCTTCTGGGAGTCTCAGGCTCATCAGCAAAGCGGTGGAACTAGTTAA