Details for Lyrate rockcress Locus 16038259

Position : sca3 ( 5`- 7531905 .. 7533300 -3` )
Annotation : [B2G] arf-gap domain 15
External links : CoGe
PGDD synteny : 16038259

Protein [Map View]
MNRKASVSKELNAKHSKILEALLKHPDNRECADCRSKAPRWASVNLGIFICMQCSGIHRSLGVHISQVRSITLDTWLPDQ
VAFMKSTGNAKANQYWESELPQHFERSSSDTFIRAKYSEKRWVSPGGIQPAPIVSQLSCKVSHLVESGYKPETPKKARTL
SLDEEILLHHVLQVTPPETRTRAGSVDMKENVYVVPLPVGMEFKKPNQKNEIFSSEINQNRRTTIAPPSSWATFDCKAMI
QAFPFYLLLIFRL*

DNA
ATGAACAGGAAGGCCTCTGTTTCCAAGGAGCTCAACGCCAAGCATTCAAAGATATTGGAAGCACTTTTAAAGCATCCAGA
CAATCGAGAATGTGCAGATTGTAGATCAAAGGCACCAAGATGGGCAAGTGTGAACCTTGGGATATTCATTTGTATGCAAT
GCTCTGGAATCCATCGTAGCCTCGGTGTCCACATCTCACAGGTAAGGTCTATAACTCTGGATACATGGCTTCCAGATCAG
GTTGCTTTCATGAAATCTACCGGTAATGCTAAGGCAAATCAGTATTGGGAATCAGAATTACCTCAACATTTCGAGAGAAG
TTCAAGCGACACGTTTATAAGAGCCAAATACAGTGAGAAGAGATGGGTTTCACCGGGAGGGATTCAACCGGCTCCTATAG
TTAGCCAGCTAAGCTGCAAAGTTAGTCACTTGGTAGAGAGCGGATATAAGCCTGAAACTCCAAAGAAAGCTAGAACTCTT
TCACTTGACGAAGAGATCCTTCTTCATCATGTTCTTCAAGTAACACCTCCAGAAACGAGAACTCGTGCGGGTTCGGTAGA
TATGAAGGAGAATGTATATGTTGTACCTCTACCAGTGGGGATGGAATTCAAGAAACCAAACCAAAAGAATGAGATTTTCT
CCAGTGAAATAAACCAGAATAGAAGAACCACCATAGCACCACCGTCAAGCTGGGCTACTTTCGACTGTAAGGCCATGATT
CAGGCTTTTCCTTTTTATCTTCTTTTAATTTTTAGGTTGTGA