Details for Lyrate rockcress Locus 16038254

Position : sca1 ( 5`- 7659998 .. 7657028 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038254

Protein [Map View]
MRISGYGIVILSLLVFSFVELSVHARPVVLVLSNDDLNSGGDDNGVGESSDFDEFGESEPKSEEELDPGSWRSIFEPDDS
TVQAASPQYYSGLKRILSAASEGNFRLMEEAVDEIEAASSAGDPHAQSIMGFVYGIGMMREKSKSKSFLHHSFAAAGGNM
QSKMALAFTYLRQDMHDKAVQLYAELAETAVNSFLISKDSPVVEPTRIHSGTEENKGALRKSRGEEDEDFQILEYQAQKG
NANAMYKIGLFYYFGLRGLRRDHTKALHWFLKAVDKGEPRSMELLGEIYARGAGVERNYTKALEWLTLAAKEGLYSAFNG
IGYLYVKGYGVDKKNYTKAREYFEKAVDNEDPSGHYNLGVLYLKGIGVKRDVRQATKYFFVAANAGQPKAFYQLAKMFHT
GVGLKKNLEMATSFYKLVAERGPWSSLSRWALEAYLKGDVGKALILYSRMAEMGYEVAQSNAAWILDKYGERSMCMGVSG
FCTDKERHERAHSLWWRASEQGNEHAALLIGDAYYYGRGTERDFVRAAEAYMHAKSQSNAQAMFNLGYMHEHGQGLPFDL
HLAKRYYDQALQSDAAARLPVTLALASLWLRRNYADTVLVRVVDSLPEVYPKVETWIENVVFEEGNATILTLFVCLITIL
YLRERQRRQVVVVADPVAADVAQPLDADVAQHLAAFPR*

DNA
ATGAGAATCTCAGGTTACGGAATCGTTATTCTCTCTTTACTCGTTTTCTCTTTCGTTGAACTTAGCGTTCACGCTCGTCC
CGTTGTTCTCGTCCTCTCAAATGACGATCTCAATAGCGGCGGCGATGATAACGGAGTCGGAGAGTCCTCTGACTTCGATG
AGTTTGGGGAATCCGAACCTAAGTCCGAAGAGGAGCTTGATCCCGGTTCATGGCGATCGATCTTCGAGCCAGATGACTCC
ACTGTCCAAGCCGCGTCGCCGCAGTACTACTCCGGCCTCAAAAGGATTCTATCGGCGGCGAGTGAGGGAAATTTCAGGTT
GATGGAGGAAGCAGTGGACGAGATAGAGGCTGCTTCTTCAGCTGGAGATCCACACGCACAGTCGATAATGGGGTTCGTTT
ACGGGATTGGAATGATGCGAGAGAAGAGCAAAAGCAAATCGTTTCTTCACCATAGTTTCGCAGCTGCTGGTGGGAATATG
CAGTCGAAGATGGCACTTGCGTTCACGTATTTGCGTCAAGATATGCATGATAAAGCTGTGCAATTATATGCTGAATTAGC
TGAGACGGCTGTCAATAGTTTTCTGATCTCAAAGGATTCTCCGGTGGTTGAACCGACTAGAATTCATAGCGGAACTGAAG
AAAACAAAGGTGCTCTAAGGAAATCCCGTGGCGAGGAGGATGAAGATTTCCAGATATTGGAATATCAGGCACAGAAAGGG
AATGCTAATGCAATGTACAAAATTGGACTATTCTACTACTTTGGCCTACGAGGATTAAGGCGTGATCACACCAAGGCATT
GCACTGGTTTTTGAAAGCAGTAGATAAAGGAGAGCCGAGGTCAATGGAACTTCTGGGGGAGATATATGCTCGAGGAGCTG
GTGTTGAAAGAAATTATACCAAGGCACTTGAATGGCTTACACTTGCTGCAAAGGAAGGTCTCTATTCAGCATTTAATGGA
ATTGGCTACTTGTATGTCAAAGGCTATGGAGTAGATAAGAAAAATTACACTAAGGCAAGAGAATATTTTGAGAAGGCTGT
TGACAATGAAGACCCCAGTGGGCATTATAACCTTGGAGTTTTGTATCTTAAAGGCATCGGAGTCAAAAGGGATGTGAGGC
AGGCAACAAAATATTTCTTTGTTGCTGCAAATGCTGGTCAACCAAAGGCTTTCTATCAACTCGCCAAGATGTTCCATACT
GGTGTTGGGCTTAAAAAGAACCTGGAAATGGCAACTTCATTTTATAAGTTGGTAGCAGAAAGGGGGCCGTGGAGTTCTCT
CTCTAGATGGGCTCTTGAAGCTTACTTAAAAGGTGATGTGGGTAAGGCTTTGATCTTGTACTCAAGGATGGCAGAGATGG
GTTATGAAGTAGCACAAAGTAACGCTGCCTGGATCCTTGATAAATACGGGGAAAGAAGCATGTGCATGGGAGTATCTGGA
TTTTGCACAGACAAAGAGAGACATGAGCGGGCACATTCTTTGTGGTGGCGGGCCTCTGAACAAGGCAATGAACATGCTGC
TCTGCTCATTGGAGATGCATATTACTATGGCCGGGGAACCGAGAGAGATTTTGTGCGTGCGGCAGAAGCATACATGCATG
CTAAATCACAGTCAAACGCGCAAGCAATGTTCAACCTCGGTTACATGCATGAACATGGACAAGGACTTCCCTTTGATCTC
CATTTAGCAAAACGTTACTATGATCAAGCCCTTCAGAGCGATGCAGCCGCCAGATTGCCAGTCACACTTGCTCTCGCTAG
CTTATGGCTCCGTAGAAACTATGCTGATACCGTCCTGGTGAGAGTTGTGGATTCATTACCAGAAGTGTATCCAAAGGTGG
AGACTTGGATAGAGAATGTGGTGTTTGAAGAAGGTAATGCAACGATACTTACACTCTTTGTCTGTCTCATTACAATTCTC
TATCTCCGGGAAAGACAACGTAGACAAGTCGTCGTTGTTGCCGATCCAGTGGCCGCTGACGTGGCACAACCCCTCGACGC
TGACGTGGCCCAACACCTCGCTGCGTTCCCACGGTAA