Details for Lyrate rockcress Locus 16038221

Position : sca3 ( 5`- 9225219 .. 9226663 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318838 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038221

Protein [Map View]
MYLAGTRLNHSAKATVFNDFEFEGSEKKKKKKLLESSNRFDHPNQEALLILCAIDNVLQRVSPIIISDLYGDGPDGREMG
PKRQRMIDQGPPGPFYGPHPGSGFMYNPYGFVAPPPPPPFPAVRLRGLPFDCAEIDVVEFFHGLDVVDVLFVHKNNKVTG
EAFCVLGYPLQVDFALQKNRQNMGRRYVEVFRSTKQEYYKAIANEVAESRVHGMASGGGGGGGGGTGGGNGGGGGGGGGR
ISGGSSPRRHVQRARSSDDGKEDIEHTGTLRLRGLPFSAGKEDILDFFKDFELSEDSVHVTVNGEGRPTGEAFVEFRNAE
ESRAAMVKDRKTLGSRYIELFPSSVEELEEALSRGR*

DNA
ATGTACTTAGCAGGCACACGCCTTAACCACTCGGCCAAAGCGACTGTTTTCAACGATTTCGAATTCGAAGGCTCAGAGAA
GAAGAAGAAGAAGAAGCTCCTCGAAAGTTCCAATCGATTTGATCATCCAAATCAGGAGGCACTGCTAATACTCTGCGCAA
TCGATAATGTTCTACAGAGGGTAAGCCCTATAATTATCTCTGACTTATATGGAGATGGTCCTGATGGGCGTGAGATGGGA
CCTAAGCGTCAAAGAATGATTGATCAAGGTCCTCCTGGACCATTTTATGGACCTCATCCTGGTTCTGGCTTTATGTATAA
CCCTTATGGATTTGTTGCTCCTCCTCCACCTCCTCCTTTTCCTGCTGTTCGACTCCGTGGTTTACCCTTCGATTGCGCAG
AGATTGATGTAGTAGAGTTTTTTCATGGTTTGGATGTGGTTGATGTCTTGTTTGTTCACAAGAATAATAAGGTCACTGGA
GAAGCCTTTTGCGTTTTGGGTTATCCCCTCCAGGTTGATTTTGCTCTTCAAAAGAACAGGCAGAACATGGGAAGGAGATA
TGTAGAAGTTTTTAGGAGTACGAAACAGGAGTACTATAAGGCTATTGCTAATGAGGTTGCCGAATCTCGTGTCCATGGTA
TGGCTAGTGGCGGTGGTGGAGGTGGCGGTGGAGGTACAGGTGGTGGCAATGGAGGTGGAGGTGGTGGCGGTGGAGGTCGA
ATTAGTGGTGGAAGTTCACCTCGCAGACATGTGCAGAGGGCTAGATCGAGTGATGATGGGAAAGAGGATATTGAACATAC
AGGTACCTTGAGACTGAGAGGATTACCGTTCTCAGCCGGAAAGGAGGACATACTTGACTTCTTCAAAGATTTCGAGCTGT
CTGAAGACTCTGTTCATGTTACTGTTAATGGTGAAGGGAGACCCACTGGGGAAGCATTTGTGGAGTTTAGGAATGCAGAA
GAGTCACGAGCTGCAATGGTTAAGGATAGGAAGACGCTTGGGAGCCGTTACATAGAATTGTTTCCTTCATCGGTTGAGGA
GTTAGAGGAGGCACTATCAAGAGGAAGGTGA