Details for Lyrate rockcress Locus 16038201

Position : sca3 ( 5`- 1130072 .. 1132302 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477606 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038201

Protein [Map View]
MASATLRRRLHHGDVDGRKYERYDATDSETLSEPLLGSSSTDNSRDEYNEERTLEDIWEEERKRQQVHWTLIFSQLIAQW
AQWIAKIVFGSGSLFGRFLLPTFGQIGTGGRLLPPPLSMLQEERLRNIKRRIEIPFDGSRMEHQDALRQLWRLAYPQREL
PPLKSELWKEMGWQGTDPSTDFRGGGYISLENLIFFAKTYPESFQRLLHKQDGTRAEWEYPFAVAGINISFMLAQMLDLQ
SGKPSTIAGIRFLGFLEEDEMAFDNLYCIAFQMMDAQWLAKRASYMEFNDVLKSTRAQLERELALDDVSSIRDLPAFNLL
YK*

DNA
ATGGCATCTGCGACTCTGAGAAGGCGGCTTCATCACGGGGATGTAGATGGGAGGAAGTATGAACGTTATGATGCAACAGA
CTCTGAAACTTTAAGCGAACCTTTGTTAGGAAGTAGTAGTACTGATAATAGTAGAGATGAGTACAATGAGGAGCGTACTC
TGGAGGATATTTGGGAAGAAGAACGGAAGAGACAGCAAGTTCACTGGACGTTGATCTTTTCTCAGTTGATTGCACAATGG
GCTCAGTGGATAGCCAAAATTGTCTTTGGATCTGGCTCACTTTTTGGGAGGTTTCTTCTTCCTACATTTGGTCAAATAGG
TACTGGTGGGAGGCTATTGCCACCGCCTCTTAGTATGTTGCAGGAAGAAAGGCTGAGAAACATTAAGCGAAGAATAGAAA
TCCCATTTGATGGATCTCGAATGGAGCATCAAGATGCTCTTAGACAACTATGGAGACTAGCTTATCCACAGAGGGAACTA
CCACCTCTTAAATCTGAACTCTGGAAGGAAATGGGTTGGCAAGGAACAGACCCTTCAACAGATTTTCGAGGTGGAGGATA
TATATCACTGGAGAATCTAATCTTCTTTGCGAAGACCTATCCGGAATCTTTCCAGAGACTGTTACATAAACAAGATGGAA
CAAGGGCCGAATGGGAATATCCTTTCGCGGTGGCTGGCATCAATATCTCATTCATGTTGGCACAAATGTTAGATCTTCAA
TCAGGTAAACCATCAACAATAGCCGGAATAAGGTTCTTGGGATTTCTGGAAGAAGACGAAATGGCATTCGATAATCTCTA
CTGTATAGCTTTCCAAATGATGGATGCACAATGGCTTGCTAAACGAGCTTCTTACATGGAATTCAATGACGTCCTGAAAT
CGACGAGAGCACAATTGGAACGTGAACTGGCACTGGATGATGTTTCAAGCATCAGAGACTTGCCTGCTTTCAATCTTTTG
TACAAATAA