Details for Lyrate rockcress Locus 16038181

Position : sca3 ( 5`- 4918480 .. 4920371 -3` )
Annotation : [B2G] dnaj heat shock n-terminal domain-containing protein
External links : CoGe
PGDD synteny : 16038181

Protein [Map View]
MENDGRSSEKNLYEVLGVEATASPQEIRKAYHKLALRLHPDKNKDDEEAKEKFQQLQKVISILGDEEKRAVYDQTGSVDD
ADLSGDVVDNLRDFFKAMYKKVTEEDIEEFEANYRGSESEKNDLIELYKKFKGKMSRIFCSMLCSNPKLDSHRFKDLIDE
AIAAGEVKSTKAYKKWAKEISEMEPPTNPQKMRRKATKGADKDLYAVISQRRDERKEKFDSMFSSLVSRYGNNADSEPNE
EEFEAAQRKVESRRSSKKSRKK*

DNA
ATGGAGAATGATGGGAGATCCAGTGAGAAAAATCTTTACGAGGTTCTTGGTGTTGAAGCAACAGCATCTCCACAAGAGAT
AAGGAAAGCGTATCATAAGTTAGCATTGAGACTTCATCCTGATAAAAACAAGGACGATGAGGAAGCTAAAGAGAAATTTC
AGCAGTTGCAAAAGGTTATTTCAATTCTCGGTGATGAAGAGAAAAGAGCAGTCTATGATCAAACTGGCTCAGTTGATGAT
GCTGATCTTTCGGGAGATGTGGTTGACAACTTGAGGGACTTCTTCAAGGCAATGTACAAGAAGGTCACGGAGGAAGATAT
TGAAGAGTTTGAGGCCAACTACAGGGGTTCTGAATCCGAGAAGAATGATTTGATTGAGCTATATAAGAAGTTTAAGGGTA
AAATGAGCAGGATTTTCTGCTCAATGCTTTGCTCAAACCCCAAGCTTGATTCACACCGTTTCAAAGATCTTATTGATGAG
GCCATTGCAGCTGGAGAAGTGAAATCAACAAAAGCTTACAAGAAATGGGCGAAGGAAATTTCAGAAATGGAACCTCCCAC
GAATCCTCAGAAGATGAGACGGAAAGCAACAAAGGGTGCAGATAAAGATTTATACGCTGTAATTTCGCAGCGAAGAGATG
AGAGGAAAGAGAAGTTCGATTCAATGTTCTCGTCACTTGTGTCTAGGTATGGTAACAATGCTGACTCTGAGCCAAATGAA
GAAGAATTCGAAGCTGCACAGAGAAAAGTTGAAAGCCGGAGATCGTCGAAGAAGTCGAGAAAAAAGTAA