Details for Lyrate rockcress Locus 16038178

Position : sca3 ( 5`- 8262758 .. 8264170 -3` )
Annotation : [B2G] dna binding protein
External links : CoGe
PGDD synteny : 16038178

Protein [Map View]
MVESELSYEQIRLKRVEENKKRMGELNLNKLAQSLRVSSSSSKPSPAKPRTMRIPVDFSEVRRSSRAKGPPPSYKEFGLE
PLERRPRRSSQRRDLLNRVYASDDARMYAFDRAEKLQSSLDPEFPSFTKPMLQSHVTGGFWLGLPLPFCKAHMPKRDEMM
TLVDEEDEESMVKYLAEKNGLSGGWRGFAIDHQLVDGDAVVFQLITRTMFKVYIIRVNEDANKDSDGNEEDEDNDNELNK
KQKENVSEARQLRSSGKRKRGGNNVSNLSLPLVIS*

DNA
ATGGTGGAATCAGAGCTAAGCTATGAGCAGATTCGTTTGAAAAGGGTGGAAGAGAACAAGAAGAGAATGGGGGAGCTTAA
TCTCAACAAGCTTGCTCAATCTCTTCGTGTCTCTTCTTCTTCTTCCAAGCCCTCTCCAGCAAAGCCAAGGACGATGCGTA
TTCCGGTGGATTTCTCGGAGGTCAGGAGATCAAGCCGTGCCAAGGGTCCACCTCCAAGTTACAAAGAGTTTGGGCTAGAA
CCACTGGAGAGGAGGCCAAGAAGGAGCTCTCAAAGAAGAGATCTGCTGAACCGGGTATATGCTTCAGACGACGCAAGAAT
GTACGCATTCGACAGGGCAGAGAAGCTTCAGTCAAGCTTAGATCCAGAATTCCCAAGCTTTACCAAACCAATGCTCCAAT
CACACGTGACCGGAGGATTTTGGTTGGGCTTGCCACTTCCTTTTTGCAAGGCACATATGCCAAAACGTGATGAAATGATG
ACTTTGGTTGACGAGGAAGATGAGGAATCTATGGTGAAATACCTTGCTGAGAAGAACGGTCTTAGCGGAGGCTGGAGAGG
TTTCGCCATCGATCATCAGTTAGTCGATGGAGATGCTGTCGTGTTTCAACTTATCACCCGAACAATGTTTAAGGTGTATA
TCATTAGGGTAAATGAAGATGCAAACAAAGATTCAGATGGGAATGAAGAAGATGAAGATAATGATAATGAATTAAACAAG
AAACAGAAGGAGAATGTTTCAGAAGCTAGACAGTTGAGAAGCAGTGGTAAAAGGAAAAGAGGAGGTAATAATGTCTCAAA
TCTCTCTTTACCTCTTGTAATATCTTAG