Details for Lyrate rockcress Locus 16038147

Position : sca3 ( 5`- 4967938 .. 4969443 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038147

Protein [Map View]
MATFALPFCEIPEDLQLRILSFLSPAEISCFACTSKRFASLCQEDGKIWHVMCDQRWGKKTKIQKWGNGQIPYRLLYKTL
KGLENLIGFWRLCGRANPAASSPPLVFFDWGPSFVLGSRVLSTGDDTYQVKKTPFLLLGISSEGRTENFLDLVGGNLRSV
DDDLKELEASDNLVSVDVNFMGNGHIMVEENRCFINNNLREEQKSSGDESDDLISSPDFSEMYTQLANKTSPGGDRRRQK
RKEKERQASRTKWEPEHFLKVADCSPTPTKPLQGLWKGFCEGSMELYLVKYDEVGGIICRKVEDLSLSRYTPPVFWTPKH
AFIRSPFSAEEELLLNSRIHISHLAEVHENVVSGILYIKSSYDLVLPGEAANGLGFLRGEGRVWLYENGTFGFGFLRDQF
VIDMKRVALEDGCLADEIEASM*

DNA
ATGGCTACATTTGCACTTCCCTTCTGCGAAATTCCCGAAGATCTCCAGCTCCGCATCTTGTCCTTCCTCTCCCCAGCAGA
GATCTCCTGCTTCGCCTGCACATCTAAACGCTTCGCCTCGCTATGTCAAGAAGACGGCAAAATCTGGCACGTTATGTGCG
ATCAGCGATGGGGCAAGAAAACGAAGATCCAGAAATGGGGAAACGGTCAAATCCCTTATAGACTCCTTTACAAGACTCTA
AAGGGATTGGAGAATCTAATTGGATTCTGGCGTCTCTGCGGCAGAGCAAATCCCGCAGCTTCATCGCCACCGCTTGTTTT
CTTCGATTGGGGTCCTTCTTTTGTATTGGGATCTAGAGTTTTATCTACCGGAGATGATACTTATCAGGTAAAGAAGACAC
CTTTCCTCTTATTGGGGATTTCGTCGGAGGGACGAACTGAGAATTTCTTGGATCTCGTCGGTGGTAATCTCAGATCTGTG
GATGATGATCTGAAAGAATTAGAAGCTTCTGACAATCTCGTCTCGGTGGATGTGAATTTCATGGGGAATGGTCATATCAT
GGTGGAGGAGAATCGATGTTTTATCAACAACAATCTTAGAGAAGAGCAGAAGAGCTCAGGAGACGAGAGTGATGATTTGA
TCTCATCGCCCGATTTTTCGGAAATGTACACTCAATTGGCGAATAAGACGAGTCCAGGCGGTGATAGAAGGAGACAGAAG
AGGAAGGAGAAGGAGAGGCAAGCGTCGAGGACTAAGTGGGAACCAGAACACTTTCTCAAAGTTGCTGATTGCTCCCCCAC
GCCTACTAAACCATTACAAGGCTTATGGAAGGGTTTCTGTGAGGGGAGCATGGAGTTATATCTGGTCAAATACGATGAAG
TTGGAGGCATTATATGCAGGAAAGTAGAGGACTTGTCTCTCTCACGGTACACTCCTCCTGTGTTCTGGACACCCAAACAT
GCGTTTATCAGATCTCCCTTTTCAGCCGAAGAAGAGCTGCTACTGAATAGTCGAATCCATATTAGCCATCTCGCCGAAGT
TCATGAAAATGTTGTATCTGGAATTTTGTACATAAAGTCTAGTTACGATCTGGTGTTGCCAGGAGAAGCGGCCAATGGCC
TTGGTTTTCTTAGAGGTGAAGGGCGGGTCTGGTTGTATGAAAATGGCACTTTTGGTTTCGGGTTTCTTCGAGATCAATTT
GTTATCGATATGAAACGTGTTGCCCTGGAAGATGGTTGTCTAGCTGACGAGATAGAAGCTTCTATGTGA