Details for Lyrate rockcress Locus 16038128

Position : sca3 ( 5`- 22295220 .. 22293277 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038128

Protein [Map View]
MEPSGDKQTSSLYPTVDTSNPEAPINPSSSSSTNNLYPSLDMNDLARNLFPEQPETSSVPVAAPPAATEEVILKISGAIL
HLIDTSYSVELACGDLSIIRIVQGENVVAVLARVGDEIQWPLTKDENSVKVDESHYFFTLRPTKEIAHDSSDEEDGAKNT
NEMLNYGLTIASKGQEHLLVELEKILEDYSCFTVQEVSEEAKEAGEKVLDVTVARETSPVELTGERKEIVERQCSAYWTT
LAPNVEDYSGKAAKLIATGSGHLIKGILWCGDVTMDRLIWGNGFMKRRLSKAEKESEVHPDTLKRIRRVKRMTKMTESVA
NSILSGVLKVSGFFTSSVANTKVGKKFFSLLPGEVILASLDGFNKVCDAVEVAGRNVMSTSSTVTTELVDHKYGGKAAEA
TNEGLDAAGYAIGTAWVAFKIRKAINPKSVLKPSTLAKTAIRSAASQKKA*

DNA
ATGGAACCCTCCGGCGACAAGCAAACTTCATCTCTCTACCCTACTGTTGACACATCGAATCCCGAAGCTCCTATAAACCC
TAGCTCTTCATCATCTACTAATAATCTCTATCCTTCTCTCGATATGAATGATCTCGCTCGTAATCTCTTCCCTGAGCAAC
CGGAGACGAGTTCCGTTCCCGTTGCGGCTCCTCCTGCAGCGACGGAGGAAGTAATTTTGAAAATCTCCGGCGCGATTCTT
CACTTAATCGACACATCTTACAGCGTCGAGCTCGCTTGCGGCGATCTTTCGATCATCCGTATTGTTCAAGGAGAGAATGT
TGTCGCTGTTCTCGCTCGTGTTGGAGATGAGATTCAATGGCCGTTGACTAAGGATGAGAACTCCGTCAAAGTCGATGAGT
CTCATTACTTCTTCACGCTTCGTCCTACCAAAGAAATCGCACATGATTCAAGCGACGAGGAAGACGGAGCGAAAAACACT
AACGAGATGTTGAACTACGGACTTACAATTGCTTCTAAAGGTCAAGAGCATCTGTTGGTGGAGCTTGAGAAGATCTTGGA
GGATTATAGTTGTTTCACGGTGCAGGAAGTGTCGGAGGAAGCGAAGGAAGCAGGGGAAAAGGTTTTGGATGTGACGGTGG
CGAGAGAGACGTCGCCGGTGGAGCTTACTGGAGAGAGGAAAGAGATTGTGGAGAGACAATGTTCGGCTTATTGGACGACT
TTAGCTCCGAATGTGGAGGATTATAGCGGGAAGGCGGCGAAGCTGATTGCAACTGGTTCAGGACATTTGATAAAAGGGAT
TCTTTGGTGTGGAGATGTGACTATGGATAGGCTCATTTGGGGAAATGGTTTCATGAAAAGGAGATTGTCAAAGGCTGAGA
AGGAGAGTGAAGTTCACCCTGACACCTTGAAAAGAATCAGGAGAGTGAAGAGGATGACCAAAATGACAGAGAGTGTAGCA
AACAGCATACTGTCTGGAGTCCTTAAAGTTTCTGGATTCTTCACAAGTTCAGTGGCAAACACCAAAGTAGGAAAGAAATT
CTTTAGTCTTCTTCCTGGAGAAGTCATCCTTGCATCTCTTGACGGATTCAATAAGGTCTGTGATGCTGTTGAAGTAGCTG
GGAGGAATGTAATGTCAACCTCTTCCACTGTCACAACTGAACTTGTTGATCACAAGTATGGTGGTAAAGCGGCTGAGGCA
ACAAACGAAGGGCTCGATGCAGCAGGATATGCGATTGGCACAGCCTGGGTTGCTTTCAAAATCAGAAAGGCTATTAACCC
TAAGAGTGTACTCAAGCCTTCGACGCTTGCAAAGACTGCCATTAGATCTGCAGCTTCACAAAAGAAAGCGTAG