Details for Lyrate rockcress Locus 16038115

Position : sca3 ( 5`- 5022654 .. 5020051 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478612 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038115

Protein [Map View]
MVFKRKLDCRFDFPNIPRAPRSCRRKVLNKRIDDDNDTQICAIDLLALAGKILQESESSSASSNAFEGNNHDKEIKQEQD
DKCKPIKSESSDQGNSVSKPTYEISTDKCVVNSFSFPDSDGVLERTPMSDYKKIHGLMDMGDVNVNTGFDQGEATDCLGD
GGLITDTCNLEDATALGVQFPKSVRVGGDLKSPSSLDMTPNGSYARHGSHTNLGSRDDDENFYSYLKLSNKFKSYRSPTI
RRIRKSLSSKYWKQVPKDFGHSRADVGVKTLYRKRKSCYGYNAWQREIIYKRRKSPDRSSVVTSDGGLSSGSVSKLPKKG
DTVKLSIKSFRIPELFIEVPETATVGSLKRTVMEAVSVLLSGGIRVGVLKHGKKLRDDRKTLSQTGISCDEILDNLGFTL
EPGPSKVPLPLCFEDPAVPTDPTSLSERSAASPMLDSGIPHAEDMINSGNIVDSNLELVPYQGDISVDEPSSDSKELVPL
PALEVKALAIVPLNQKPKRTELAQRRTRRPFSVTEVEALVQAVEELGTGRWRDVKLRAFEDADHRTYVDLKDKWKTLVHT
ASISPQQRRGEPVPQELLDRVLRAYGYWSQHQGKHQARGASKDPEMNRGIAPESGVSV*

DNA
ATGGTGTTCAAGAGGAAGTTAGATTGCCGCTTTGATTTCCCCAATATTCCCAGGGCTCCTCGTTCATGCAGGAGGAAGGT
CCTAAACAAGAGGATTGATGATGATAATGACACTCAGATCTGTGCAATTGACTTACTAGCTTTGGCTGGAAAGATTCTAC
AGGAAAGCGAGAGTTCCTCCGCGTCGTCCAATGCATTTGAAGGGAATAATCACGATAAAGAAATTAAACAAGAGCAAGAT
GATAAATGCAAGCCTATTAAATCCGAGTCTTCTGACCAAGGAAACTCTGTGTCAAAGCCTACTTATGAAATCTCTACTGA
CAAGTGTGTGGTGAACAGTTTTTCATTTCCGGATAGTGACGGCGTTTTGGAGCGAACTCCTATGTCTGACTACAAGAAGA
TTCATGGTTTGATGGACATGGGTGATGTTAATGTGAATACTGGGTTTGACCAAGGAGAAGCAACTGATTGCTTGGGAGAT
GGAGGCTTAATCACTGATACTTGCAACTTAGAGGATGCAACTGCGTTAGGTGTGCAGTTTCCGAAATCAGTCCGTGTGGG
TGGTGATCTAAAATCACCATCCAGCTTGGATATGACCCCTAATGGTTCCTATGCTAGACATGGGAGTCATACTAACCTAG
GTAGTAGAGATGATGATGAAAATTTTTATAGTTACCTGAAACTTAGCAATAAATTTAAGTCGTATAGGTCTCCTACAATT
CGAAGAATAAGAAAGTCGCTGTCGTCCAAATACTGGAAACAAGTTCCCAAAGATTTTGGACACAGTAGAGCTGATGTCGG
TGTAAAGACTCTTTATCGCAAAAGAAAATCATGTTATGGATACAACGCATGGCAGCGTGAGATCATTTATAAGAGAAGAA
AATCACCTGACAGAAGCTCGGTCGTAACTTCTGATGGAGGACTCAGTAGTGGAAGTGTTTCCAAGTTACCCAAGAAGGGA
GATACAGTAAAGCTAAGCATTAAGTCCTTTAGGATTCCAGAGCTTTTTATTGAAGTTCCAGAAACTGCAACAGTAGGATC
ACTAAAGAGGACGGTGATGGAGGCTGTCAGTGTTTTACTCAGCGGAGGAATACGTGTTGGGGTATTAAAGCATGGGAAGA
AGCTTAGAGATGACAGGAAAACTCTGTCACAGACTGGGATCTCATGTGATGAAATTCTAGACAACCTTGGGTTCACCTTG
GAGCCTGGTCCCAGCAAAGTTCCCCTACCTTTGTGTTTCGAAGATCCTGCTGTGCCAACCGACCCTACGAGTTTGTCTGA
ACGGTCTGCGGCGTCTCCCATGTTAGATTCTGGAATTCCCCATGCAGAGGACATGATTAATTCAGGAAATATTGTGGACA
GTAACCTCGAATTAGTTCCATATCAGGGGGACATATCTGTTGATGAACCTTCATCGGATTCAAAAGAGCTTGTTCCACTT
CCAGCCTTGGAAGTTAAGGCGCTTGCCATAGTTCCGTTGAACCAGAAACCTAAGCGTACTGAGCTAGCCCAGCGCAGAAC
CAGGAGACCCTTCTCTGTGACAGAGGTAGAAGCTCTTGTACAAGCAGTTGAGGAACTCGGGACTGGAAGATGGCGTGATG
TGAAATTGCGTGCTTTCGAGGATGCAGATCATCGGACTTACGTGGACTTGAAGGACAAATGGAAGACGCTTGTTCACACA
GCAAGTATATCACCTCAGCAACGAAGAGGAGAGCCGGTGCCACAAGAACTCCTAGACAGAGTCTTGAGGGCATACGGGTA
TTGGTCGCAGCACCAAGGTAAACATCAAGCGAGAGGAGCTTCCAAAGATCCAGAGATGAACAGAGGTATAGCTCCTGAAT
CAGGTGTTTCAGTGTAA