Details for Lyrate rockcress Locus 16038111

Position : sca3 ( 5`- 22304129 .. 22303653 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_480688 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038111

Protein [Map View]
MLSSSSSFFATPFLSSSSSPPFSLVSPPSIVSRISPSLSATTASYTCADDPPRLRQIPQRFSATASLYEILEIPVGSTSQ
EIKSAYRRLARICHPDVAGNSRNSSSADDFMKIHAAYCTLSDPEKRAVYDRRNLRRSRPLTAGYGSYGGRNWETDQCW*

DNA
ATGCTCTCTTCTTCTTCAAGTTTCTTCGCTACTCCATTTCTCTCTTCTTCTTCTTCTCCGCCGTTCTCTCTTGTTTCACC
ACCGTCAATTGTTTCCCGGATCTCGCCGTCTCTTTCTGCAACCACCGCTTCCTACACCTGCGCCGATGATCCACCGAGAT
TACGCCAAATCCCGCAGCGATTTTCAGCGACCGCGTCTCTCTACGAGATCCTTGAAATTCCCGTCGGCTCGACTAGTCAA
GAGATCAAATCGGCTTACCGACGATTAGCTAGGATCTGTCATCCCGATGTAGCGGGAAATAGTCGGAATAGCTCGTCGGC
GGACGATTTTATGAAGATCCACGCGGCGTATTGCACGCTTTCGGATCCCGAGAAACGCGCCGTTTATGATCGGAGGAATC
TTCGACGGAGCCGGCCGTTAACTGCTGGATACGGCAGTTACGGCGGACGGAATTGGGAAACGGATCAGTGCTGGTAG