Details for Lyrate rockcress Locus 16038083

Position : sca3 ( 5`- 7460004 .. 7462049 -3` )
Annotation : [B2G] domain-containing protein
External links : CoGe
PGDD synteny : 16038083

Protein [Map View]
MSVIRPSPIPIPRCRSQLLHRRLYSIQLIQRRRRRWNPRSEVEDTAVESTARSPEAAGGKMVVELVGAFNEVTERMNSVW
LSTSSSRLLFKALKLSIPILQSLPLASDGRSPLSKALSLSIILADLQMDAEVISASILSEVVEAKAISIYEVRDQIGTGT
AHLLHEIFRVKNIPFKVDVLDDETAASLRKFYLTYYDIRAVIMDLVSKLDEMRHLDHLPRYRQQILSLEVLKIYSPLAHA
VGANHLSLELEDISFRYLFPCSYLYLDSWLRGHENGSKPLIDMYKEQLYLSLKADLVLAEMVDDVYIKGRYKSRYSMMKK
LLRDGRKPEEVNDVLGLRVILIPNSVTNDVEVGEKACYRTSEIIRSLWKEIPHRTKDYIARPKANGYKSLHMAVDVSDSD
QTRPLMEIQIRTMDMDGSANAGTASHSLYKGGLTDPKEAKRLKAIMMAAADLAAIRLKDLSSNKHQSFKTTTNQRDRVFC
LLDKNGDGMISIEELMEVMEELGAPGEDAEEMMQLLDSNSDGSLSSDEFYTFQKQVEFMRKWEDRDNEYKSLLDEKLHDL
PHQDTTGLIQLYKKELEDRLSTH*

DNA
ATGTCTGTCATTCGTCCTTCTCCGATTCCAATTCCAAGATGCAGATCCCAGTTGCTGCATCGTCGTCTTTACTCGATCCA
ATTGATTCAGAGACGACGTCGACGGTGGAATCCGAGGTCAGAGGTGGAAGATACTGCGGTTGAATCGACGGCTCGGTCTC
CGGAGGCAGCGGGAGGGAAAATGGTTGTGGAGCTTGTTGGAGCTTTCAACGAAGTAACGGAGAGGATGAATTCGGTTTGG
TTGTCGACGTCTTCGTCTAGATTACTCTTTAAAGCTCTGAAGCTCTCGATTCCGATTTTACAGTCTCTTCCTCTTGCCTC
TGATGGTCGCTCTCCTCTTTCTAAGGCTCTTTCACTCTCTATCATACTCGCAGATCTCCAGATGGATGCGGAAGTTATAT
CGGCGAGTATATTGAGTGAGGTGGTGGAGGCGAAAGCGATATCTATATATGAAGTTAGAGACCAGATTGGTACTGGAACT
GCTCATCTGCTTCATGAGATTTTTCGTGTTAAGAACATCCCTTTTAAAGTTGATGTCTTGGACGACGAAACTGCTGCTTC
ATTGAGAAAGTTCTATTTAACCTACTATGACATCAGAGCTGTGATCATGGACTTGGTTTCAAAGCTTGATGAGATGAGGC
ATTTGGATCACTTGCCAAGATATCGCCAGCAGATTCTCTCCCTTGAAGTGTTGAAGATTTATTCTCCTTTAGCTCATGCG
GTTGGGGCTAATCACCTGTCACTTGAGCTCGAGGACATCTCTTTCCGTTATCTTTTCCCGTGTTCGTATCTATACTTAGA
TTCATGGTTAAGAGGTCACGAGAACGGGTCTAAACCGTTGATAGACATGTACAAAGAGCAGCTTTATCTGTCTTTGAAGG
CTGATTTGGTTTTGGCTGAAATGGTGGATGATGTATATATTAAAGGTCGGTATAAAAGCCGGTACAGTATGATGAAGAAG
CTCTTAAGAGACGGGCGTAAACCGGAAGAAGTGAACGATGTGCTTGGTCTACGGGTCATATTGATACCGAATTCTGTAAC
AAACGATGTTGAAGTGGGAGAAAAAGCCTGTTACAGAACAAGTGAGATTATCCGGTCTTTGTGGAAGGAGATTCCACATA
GAACAAAAGACTACATTGCTAGGCCGAAGGCAAATGGGTATAAGAGTCTACACATGGCGGTTGATGTTAGCGACAGCGAT
CAGACAAGACCTTTGATGGAGATACAAATACGAACAATGGATATGGATGGATCTGCTAATGCTGGAACAGCATCACATTC
TTTGTATAAAGGCGGTCTAACCGACCCAAAAGAGGCGAAGCGGCTTAAAGCAATAATGATGGCAGCAGCAGATCTTGCAG
CGATTCGACTCAAAGATCTCTCATCAAATAAACACCAAAGCTTCAAGACAACAACGAACCAGAGAGACAGAGTATTTTGC
CTTCTGGACAAAAACGGGGACGGAATGATCAGCATAGAGGAACTAATGGAAGTGATGGAAGAGCTTGGAGCTCCAGGTGA
AGACGCAGAGGAAATGATGCAGCTTCTTGACTCTAACAGCGATGGATCTCTTAGTTCAGACGAATTCTATACGTTCCAGA
AACAAGTTGAGTTCATGCGTAAATGGGAAGATAGAGATAACGAATACAAGAGTCTTTTAGATGAAAAGCTTCATGATCTC
CCACATCAAGATACCACAGGTTTGATACAGTTATACAAGAAAGAGCTTGAGGATCGTCTCTCAACCCATTAA