Details for Lyrate rockcress Locus 16037995

Position : sca3 ( 5`- 1454814 .. 1455210 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037995

Protein [Map View]
MNIVIENNPSSRRLSDLGVMSWPKWSCQPGKYALVFEERETCYLVKGKVKVYLKGSSEFVEFGAGDLVTIPKGLSCTWDV
SLFIDKHYKFDPPTSP*

DNA
ATGAATATTGTAATCGAAAACAACCCTTCAAGCAGAAGGTTATCCGACCTTGGAGTCATGTCATGGCCTAAATGGTCTTG
TCAGCCGGGGAAATATGCATTGGTATTTGAAGAAAGAGAAACATGCTATCTAGTGAAGGGAAAGGTGAAGGTGTATCTAA
AAGGGTCATCTGAGTTTGTAGAGTTTGGTGCAGGAGACCTTGTGACCATCCCCAAGGGACTTAGCTGCACTTGGGATGTA
TCACTTTTCATCGACAAACACTACAAGTTCGATCCTCCTACTTCTCCATAA