Details for Lyrate rockcress Locus 16037918

Position : sca3 ( 5`- 10097359 .. 10096838 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479775 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037918

Protein [Map View]
MDSPIIFLRPFNVSDAEDVLKWAGDDDVTRYLRWDSVQTIEEAKQHILNKAIPHQWRRSISLVQHGRSLGYVSVKPDSGD
GRCRADLAYAIAKEFWGRGIATAAVRMAVEQAFEDFPELVRLQAVVEVENKASQRELEKAGFRKEGLLEKYGFSKGVIKD
MFLYSFVKDDCFV*

DNA
ATGGATTCACCTATAATCTTTCTCCGGCCGTTCAATGTCTCAGATGCCGAAGACGTCCTCAAATGGGCCGGTGACGATGA
CGTGACACGTTACCTCCGTTGGGACTCCGTTCAAACCATAGAAGAAGCCAAACAACACATCTTAAACAAGGCTATACCAC
ACCAATGGCGCCGTTCCATCTCTCTCGTCCAACACGGTCGTTCGTTAGGTTACGTCTCCGTCAAGCCAGATTCAGGTGAT
GGTCGGTGCCGAGCCGACCTTGCATACGCTATAGCTAAAGAGTTTTGGGGGCGAGGGATAGCCACGGCGGCGGTGAGGAT
GGCGGTGGAACAAGCTTTCGAGGATTTTCCGGAGTTGGTGAGGCTACAAGCGGTGGTGGAGGTGGAGAACAAAGCGTCTC
AAAGGGAGTTGGAGAAAGCTGGATTTCGAAAAGAGGGTTTGCTTGAGAAGTATGGTTTTAGCAAAGGAGTGATAAAAGAC
ATGTTTCTCTATAGTTTTGTTAAAGATGATTGTTTTGTGTAA