Details for Lyrate rockcress Locus 16037881

Position : sca3 ( 5`- 4265457 .. 4263985 -3` )
Annotation : [B2G] glycosyl transferase family 1 protein
External links : CoGe
PGDD synteny : 16037881

Protein [Map View]
MDQPPDRSKRPWKFSTLVYSSSILFLLLSIFLFGFTNTNLYKVQSLRFTFTANRIYSYLQFLLGFHDGTPKSKSETLDPA
SSTSHCVLWMAPFLSSGGYSSEAWSYILSLHNHLTNPRFRITIEHHGDLESVEFWNGLAKETKELAIEMYRTQCRPNETI
VVCHSEPGAWYPPLFETLPCPPTGYEDFLSVIGRTMFETDRVNPEHVKRCNQMDHVWVPTEFHVSSFVQSGVDSSKVVKI
VQPVDVGFFDPLKYEPLDLMAVGDLVLGSGMKNAGLGFVFLSVFKWEQRKGWDVLLKAYLREFSGKDNVALFLLTNAYHS
DSDFGNKILDFVEELNIQELRNGYPFVYVIDKHIAQVDLPRLYKAADAFVLPTRGEGWGRPIVEAMAMSLPVIATNWSGP
TEYLTERNGYPLVVEEMSEVKEGPFEGHQWAEPSVDKLRVLMRHVMSNLDEAKVKGNRGRDDMIQKFAPEVVAKVVADQI
ERIFDEKIRT*

DNA
ATGGATCAACCACCAGATCGGAGCAAGCGACCATGGAAATTCTCCACCTTGGTCTACTCTTCATCGATCCTTTTCCTTCT
TCTTTCGATATTCTTATTCGGCTTCACTAATACCAATCTCTACAAAGTCCAAAGTCTGAGATTCACCTTCACTGCGAACC
GCATCTACAGCTATCTTCAATTCCTTCTAGGCTTTCACGATGGAACTCCCAAATCCAAATCTGAAACCCTAGACCCAGCT
TCGTCTACGTCGCATTGCGTGTTATGGATGGCTCCTTTTCTCTCGAGTGGCGGTTATAGCTCAGAAGCTTGGTCTTACAT
TTTATCACTTCATAACCATCTCACAAACCCTAGATTTCGAATCACCATCGAGCACCATGGTGATCTAGAATCAGTGGAGT
TTTGGAATGGTTTAGCTAAGGAGACTAAGGAGCTAGCGATTGAAATGTACAGAACACAATGTAGACCCAACGAGACGATC
GTTGTTTGTCATAGTGAACCTGGTGCTTGGTATCCACCATTGTTTGAGACTCTTCCTTGTCCTCCAACTGGTTACGAAGA
TTTCTTATCTGTGATTGGTAGAACAATGTTTGAGACTGATAGAGTCAATCCTGAGCATGTGAAGCGATGTAATCAGATGG
ATCATGTTTGGGTTCCTACTGAGTTTCATGTCTCTTCCTTTGTACAAAGTGGGGTTGATTCATCTAAGGTTGTCAAGATT
GTGCAGCCTGTAGATGTCGGTTTCTTCGATCCTTTAAAGTATGAGCCTTTGGATCTGATGGCGGTTGGGGATTTGGTTTT
GGGTTCTGGAATGAAGAATGCGGGTTTAGGGTTTGTGTTCTTGAGTGTGTTTAAGTGGGAGCAGAGGAAAGGTTGGGATG
TGTTGTTGAAGGCTTACCTCAGAGAGTTCTCTGGTAAAGACAATGTTGCTCTATTTTTGTTGACAAACGCTTATCACTCG
GACAGCGATTTCGGGAACAAGATTCTTGATTTCGTAGAAGAATTGAATATACAAGAGCTTCGAAATGGTTACCCTTTTGT
GTATGTGATTGATAAACACATAGCTCAAGTTGATTTGCCTCGGTTGTACAAAGCGGCTGATGCGTTTGTGTTGCCTACAC
GAGGAGAAGGATGGGGACGACCTATAGTGGAAGCCATGGCAATGTCTTTGCCTGTGATCGCAACAAACTGGTCAGGACCA
ACAGAGTATCTTACAGAGCGTAATGGTTACCCGTTGGTGGTAGAGGAGATGAGTGAAGTAAAGGAAGGTCCTTTTGAAGG
GCATCAATGGGCTGAGCCATCTGTGGATAAGCTTAGGGTTCTAATGAGGCATGTGATGAGTAATCTTGATGAGGCTAAGG
TTAAAGGAAACCGTGGAAGAGACGACATGATCCAGAAGTTTGCTCCTGAGGTTGTTGCTAAGGTTGTAGCGGATCAAATA
GAGAGAATCTTTGATGAGAAAATAAGAACATGA