Details for Lyrate rockcress Locus 16037872

Position : sca2 ( 5`- 16432668 .. 16427461 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476613 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037872

Protein [Map View]
MGGGNLHSLPPENASAVTVGNTKLSDAPVLFFVYCHKAFRAQLVDLRRFATDAAEADSFSGDLAVELSRKFEFLKLVYKY
HSAAEDEVIFLALDKRVKNIVSNYSLEHAGTDDLFTSIFHWLHVLEEEIGSTSDVLREVILCIGTIQSSICQHMLKEERQ
VFPLLIEKFSFREQASLVWQFICSVPVMVLEDFLPWMMSYLSHEEKIEVENCIKDVAPAEDSMQQVISSWLLDDSQSSYG
TPTEIMKGVQYVNVSKSMKKSPESHPSSGCFQRFWEWSKKSLSIPNVGRSPIHGLRLFQNAIEKDLRDIQEGLCRAKFSS
LLVDLDVLMARLNFLADVLVSYSNAFKKFFHPVLEEMTARPSSTAKQFNIDGCLENFQRFLYKSADDKTRTDDFLLQLQE
ELESLIVQVTNQFSVQRTEVFPIISKNCNHEMQKQLLYTSIHVLPLGLLKCVILWFSAHLSEEESQSILHFLSLEDSSPK
KSFPRLLLQWLRFGYSGKTSVETFWKQLAVMFKVRCSCQKDHNEEASGSFSNQTQMQLCKGSKVVCPRKKDKSSTCFMSM
DLAAGDMYETPYSSRMNQQMIFSGKLKPPLHLPNFFGEKNMDDPSIMDVKPIDLLFFFHKAMKMDLDYLVCGSARLAADF
RFLAEFQQRFHMIKFLYQIHSDAEDEIAFPALEAKGQLKNISHSFGIDHELETKHFDKVSFILNEMAELNMLVSTINTNA
VDHHRKTKYERLCLSLQEICKSMHKLLSEHIQHEETELWGLFRNCFSIEEQEKMIGCMLGRISGEILQDMIPWLMESLTS
DEQLAAMSLWRQVTRKTMFVEWLTEWYNGHVLQEEAGESNNDPFGDSDPLEIVWKYLFEAAADGDIGSNLVQLSETDFTG
MMNQPPHNNNVELGNKEEKDLERSESKKICRGADQKRDKEQTDNNFQTRNPSQTFQMSQKVSQFGPSKRYEQLLTMSEEE
LVVVIKKISCDSSLNPQKKSYIKQNLLMSRWNISQRTNILEPSSLSSNMETVPGQHPSYRDPHSLIFGCNHYKRKCKLFA
PCCDKLFTCIRCHDEEADHSVDRKQITKIMCMKCLLIQPIGANCSNTSCKSSMGKYFCQICKLYDDERKIYHCPYCNLCR
VGKGLGIDYFHCMKCNACMSRTLVEHVCREKCLEDNCPICHEYIFTSSSPVKALPCGHLMHSTCFQEYTCSHYTCPICSK
SLGDMQVYFKMLDALLAEEKMPDEYSNKTQVILCNDCGRKGNAPYHWLYHKCTSCGSYNSRLL*

DNA
ATGGGAGGCGGAAATCTTCATTCCCTTCCGCCCGAAAATGCTTCTGCGGTTACCGTTGGAAATACCAAGCTTTCTGATGC
TCCGGTTCTTTTCTTCGTTTACTGCCACAAGGCTTTTCGTGCTCAGCTGGTGGACCTCCGGCGTTTCGCTACTGACGCTG
CAGAAGCTGATTCCTTTAGCGGGGATCTGGCGGTGGAGCTCTCCCGGAAGTTTGAGTTTTTGAAGCTTGTATATAAGTAT
CATAGTGCAGCTGAAGATGAGGTTATATTTTTGGCGCTTGATAAACGAGTAAAAAACATAGTTTCTAATTATTCACTTGA
GCATGCTGGCACAGATGATCTCTTCACCTCAATTTTTCATTGGCTACATGTTCTTGAGGAAGAAATAGGAAGCACAAGTG
ATGTTCTTCGTGAAGTTATATTATGTATAGGCACCATTCAATCATCTATATGCCAACATATGCTTAAAGAAGAGCGTCAG
GTCTTTCCTTTGTTAATTGAGAAGTTCTCTTTCCGAGAACAGGCGTCACTTGTGTGGCAATTCATATGTAGTGTTCCAGT
GATGGTGCTTGAAGACTTTTTGCCATGGATGATGTCTTATCTCTCTCACGAGGAGAAAATTGAAGTTGAGAATTGCATTA
AAGATGTTGCCCCAGCTGAAGACTCAATGCAACAGGTCATAAGCTCTTGGCTTCTTGACGACAGTCAATCTTCTTATGGG
ACTCCTACAGAGATCATGAAAGGAGTCCAGTATGTTAATGTGTCTAAAAGTATGAAGAAATCACCTGAGTCACATCCGTC
CAGCGGATGTTTTCAACGGTTTTGGGAGTGGAGTAAAAAGTCCCTTTCTATTCCAAATGTAGGACGCAGCCCGATTCATG
GTCTTCGACTTTTTCAAAATGCAATTGAAAAGGATTTGAGAGATATTCAAGAAGGATTATGCAGAGCAAAATTCTCAAGC
CTTCTTGTGGACCTTGATGTACTGATGGCCCGATTAAACTTCCTTGCTGATGTCCTTGTTTCTTATAGCAATGCATTTAA
GAAGTTCTTTCACCCAGTGTTAGAAGAAATGACAGCTCGCCCCTCTTCAACTGCCAAACAATTCAACATAGATGGTTGTC
TTGAGAATTTTCAGAGATTTCTATACAAAAGTGCTGATGATAAAACAAGGACAGATGATTTTCTATTGCAGCTTCAGGAG
GAACTTGAGTCCCTTATAGTACAAGTAACAAATCAATTTTCTGTACAGCGAACAGAGGTATTCCCAATCATCAGCAAGAA
TTGCAACCATGAAATGCAGAAGCAGCTCCTATACACAAGCATTCATGTCTTACCTCTTGGATTGCTAAAGTGTGTCATAC
TTTGGTTTTCTGCTCATCTATCAGAAGAGGAATCTCAATCAATTCTTCATTTCTTAAGTTTGGAAGATTCTTCTCCCAAG
AAATCATTTCCACGCCTCTTGCTACAGTGGCTTCGTTTTGGCTACTCAGGAAAAACCTCTGTTGAAACTTTTTGGAAACA
GCTGGCAGTGATGTTCAAAGTAAGATGTTCCTGCCAAAAAGATCACAATGAAGAAGCATCAGGATCATTTTCCAACCAAA
CACAGATGCAACTATGCAAAGGATCTAAAGTTGTTTGTCCTAGAAAGAAAGATAAGTCTTCAACCTGCTTCATGTCAATG
GATCTAGCTGCTGGAGACATGTATGAGACACCTTACTCTAGTCGAATGAATCAGCAAATGATTTTCTCGGGAAAGCTCAA
GCCTCCTCTCCATCTTCCAAATTTTTTTGGTGAGAAGAATATGGATGATCCATCGATAATGGATGTAAAACCAATTGACC
TCCTTTTCTTCTTCCATAAGGCAATGAAGATGGATTTGGACTACCTTGTTTGTGGATCGGCAAGATTGGCAGCCGACTTT
CGGTTCCTCGCGGAGTTTCAACAGCGATTCCATATGATAAAGTTCTTGTATCAGATACATTCGGATGCAGAGGATGAAAT
TGCATTTCCAGCATTGGAGGCCAAGGGACAACTTAAAAACATTAGTCACTCATTTGGCATTGATCATGAGCTAGAAACTA
AACACTTCGACAAAGTTTCATTCATTTTGAATGAGATGGCAGAACTGAACATGTTGGTTTCTACCATAAATACCAATGCA
GTGGACCACCATCGAAAGACGAAGTATGAGCGGTTATGTCTGAGTCTCCAAGAGATTTGCAAATCTATGCACAAGCTGTT
GTCTGAGCATATCCAACATGAAGAAACTGAGCTATGGGGTCTATTCAGAAACTGCTTCTCTATTGAAGAACAAGAGAAAA
TGATAGGATGCATGCTTGGGAGAATAAGTGGGGAAATATTGCAGGATATGATTCCTTGGTTAATGGAATCATTGACTTCT
GATGAACAGCTTGCCGCGATGTCCTTGTGGCGCCAAGTAACTAGGAAAACAATGTTTGTCGAATGGCTAACAGAATGGTA
CAACGGTCATGTTTTACAAGAGGAAGCAGGAGAATCAAACAATGATCCATTTGGGGATTCAGATCCACTAGAGATTGTTT
GGAAGTATCTCTTTGAAGCAGCTGCTGATGGGGACATAGGGAGCAACCTTGTCCAACTCTCAGAAACAGACTTCACGGGT
ATGATGAATCAGCCACCTCATAATAACAATGTTGAACTCGGCAACAAAGAGGAGAAGGATCTAGAACGCTCAGAAAGTAA
AAAGATATGTAGAGGAGCTGACCAAAAGAGGGACAAAGAACAAACTGACAACAATTTCCAGACAAGAAATCCTAGTCAGA
CTTTCCAAATGTCTCAGAAGGTTAGCCAGTTTGGTCCATCCAAGAGATATGAACAATTGTTAACAATGAGTGAGGAAGAA
CTTGTGGTTGTGATTAAGAAAATATCATGCGACTCTTCCTTGAATCCTCAGAAGAAATCCTATATCAAGCAGAATTTGTT
AATGAGTCGGTGGAATATCTCACAACGTACAAATATTTTGGAACCATCATCTCTCTCAAGCAACATGGAAACAGTTCCTG
GTCAACATCCATCATATCGAGATCCTCATAGTTTGATCTTTGGTTGCAATCATTACAAGAGAAAATGCAAGCTTTTTGCT
CCTTGTTGTGACAAGCTGTTCACATGTATACGATGCCATGATGAAGAAGCTGATCACTCGGTGGATAGGAAACAGATTAC
AAAGATAATGTGCATGAAATGCCTCTTGATCCAGCCGATTGGTGCAAATTGCTCAAATACTTCATGTAAATCGTCAATGG
GAAAATACTTTTGCCAAATATGCAAATTATATGACGATGAAAGGAAAATATATCACTGCCCTTACTGCAACCTCTGCCGG
GTAGGGAAAGGACTGGGCATTGATTACTTCCATTGCATGAAATGCAATGCTTGCATGTCACGTACCTTAGTAGAGCATGT
TTGCAGGGAAAAGTGCTTAGAAGATAATTGCCCTATATGCCACGAGTATATCTTCACCTCCAGCTCTCCTGTGAAGGCTC
TTCCTTGCGGTCACTTGATGCACTCCACATGCTTTCAGGAGTACACATGTTCACATTACACATGCCCTATCTGCAGCAAG
TCACTAGGAGATATGCAGGTCTACTTTAAGATGTTAGACGCATTGCTTGCAGAAGAGAAGATGCCTGATGAATACTCCAA
CAAAACTCAGGTGATCTTGTGTAATGACTGTGGAAGAAAAGGAAATGCTCCTTACCATTGGCTTTACCACAAATGCACAA
GCTGTGGCTCCTACAATTCAAGGCTCCTTTAG