Details for Lyrate rockcress Locus 16037868

Position : sca3 ( 5`- 1667916 .. 1666308 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477747 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037868

Protein [Map View]
MSAESASQIPKGQVDLLDFIDWSGVECLNQSSNHSLPNALKQGYREDEGLNLESDADEQLLIYIPFNQVIKLHSFAIKGP
EEEGPKTVKFFSNKEHMCFSNVNDFPPSDTAELTEENLKGKPVVLKYVKFQNVRSLTIFIEDNQSGSEVTKVQKIALYGS
TVETTDMKGLKKIEDH*

DNA
ATGTCCGCCGAATCAGCTAGCCAAATTCCTAAGGGACAGGTTGATCTACTAGATTTTATTGACTGGTCTGGTGTTGAATG
CCTTAACCAAAGCTCAAATCACTCTTTGCCCAATGCTCTCAAGCAGGGTTATAGAGAAGATGAAGGTTTAAACTTAGAGA
GTGATGCTGATGAACAACTTCTGATCTACATTCCTTTTAACCAAGTTATCAAACTACATTCTTTTGCTATCAAAGGGCCT
GAAGAGGAAGGTCCTAAAACTGTAAAGTTTTTTTCAAACAAAGAGCACATGTGCTTCAGCAATGTCAATGATTTTCCTCC
AAGCGACACCGCTGAACTAACTGAAGAAAACCTCAAGGGAAAACCGGTGGTCCTTAAATACGTCAAGTTTCAGAATGTTC
GTAGCTTGACGATCTTCATCGAAGACAACCAATCAGGTTCTGAGGTCACCAAGGTTCAGAAGATTGCTCTCTATGGCTCA
ACGGTGGAGACGACTGATATGAAGGGATTGAAAAAGATTGAAGATCACTGA