Details for Lyrate rockcress Locus 16037866

Position : sca3 ( 5`- 7783241 .. 7781689 -3` )
Annotation : [B2G] nodulin 21 family protein
External links : CoGe
PGDD synteny : 16037866

Protein [Map View]
MGKGVVSEKVKLVVALITLQFCFAGFHIVSRVALNIGVSKVVYPVYRNLLALLLIGPFAYFFEKKERPPLTISLLAQFFF
LALIGITANQGFYLLGLYYATPTFASAMQNSVPAITFIMACTLRLEHIDLVRKHGVAKVLGTLVSIGGATVITLYRGFPI
FDQGLNMQKEEVIGSDKSSHNWKLGWLYLMGHCLSWAGWMVLQAPVLKQYPAKLTLTSFTCFFGLIQFLVIALFVETDLN
NWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKSGPVFVAVFQPLQTLLVAAMAFLILGDQLYSGRIVGAVFIMLGLYL
VLWGKNEERKLVLEESQQDPESLTKNLLEAQHQKSISESEV*

DNA
ATGGGGAAAGGAGTAGTATCAGAGAAGGTGAAGCTTGTGGTGGCATTGATCACACTTCAGTTCTGTTTCGCAGGCTTCCA
CATTGTCTCAAGAGTTGCTCTTAACATTGGTGTCAGCAAAGTTGTGTACCCTGTTTATCGGAATCTCCTTGCCCTTCTCC
TCATAGGTCCCTTCGCTTACTTCTTCGAAAAAAAGGAAAGACCTCCACTCACAATCTCTTTACTGGCGCAGTTCTTCTTC
TTGGCACTCATAGGAATCACAGCGAACCAAGGATTTTACCTATTGGGACTTTACTATGCAACTCCAACGTTTGCTTCCGC
AATGCAGAACTCTGTTCCTGCCATCACTTTCATCATGGCTTGTACACTAAGGTTAGAGCACATAGACCTGGTCAGGAAAC
ATGGTGTGGCCAAAGTATTGGGAACTCTTGTGAGCATCGGTGGAGCCACCGTGATCACATTATACAGAGGATTTCCGATA
TTTGACCAGGGCCTTAACATGCAAAAGGAAGAGGTGATCGGATCTGACAAATCATCGCACAACTGGAAACTCGGATGGTT
ATACCTTATGGGACATTGTCTGTCATGGGCTGGTTGGATGGTTCTTCAAGCTCCTGTTCTAAAGCAATACCCGGCAAAGC
TCACTTTAACATCCTTCACATGTTTCTTTGGTCTGATTCAGTTTCTGGTCATTGCTCTGTTTGTGGAAACTGATCTTAAT
AACTGGATCATCGTCTCATGGGAAGAGCTCTTCACCATCCTATACGCTGGAATAATAGCATCAGGGTTGGTGGTGTATCT
TCAAACATGGTGTATTTACAAAAGCGGTCCAGTCTTTGTCGCTGTCTTCCAGCCTCTCCAGACACTTCTTGTTGCTGCAA
TGGCGTTTCTTATTCTTGGTGATCAGTTATACTCCGGAAGGATTGTTGGTGCAGTGTTCATAATGCTAGGGCTCTACTTA
GTTCTTTGGGGGAAAAACGAAGAAAGAAAACTGGTTCTTGAAGAAAGTCAACAAGATCCAGAGTCATTGACCAAAAATCT
ACTTGAGGCACAACACCAGAAGAGTATTTCTGAATCTGAAGTGTAA