Details for Lyrate rockcress Locus 16037864

Position : sca3 ( 5`- 12752327 .. 12753172 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037864

Protein [Map View]
MAIFSRTKRVTDPLDDDAKARIFSSHGCILDQDSPRLYELVHGFFEDGPEETFYDSDSKLSENSVVECPSEDSEEILRMA
VSLSDSDPYQNLLLAHVLRAVEAYSGFRSRNKSVFGDKVVSFLRELGYNAAVCVSKWTSSAKLIAGSYQFIDVVYKPSDN
DQTAVRYFVDLDFASEFEIARPTREYTRVLQLLPNVFVGKEENLRTIVRESCDAAKRSLKSRGLSLPPWRRSSYLQHKWF
SPYKRKVGSSLGVKPLNSDAVSCRSLGYDDGAVNTRLFIRA*

DNA
ATGGCGATTTTCTCAAGAACCAAACGTGTCACTGACCCACTTGACGACGACGCCAAGGCTCGGATCTTCAGCAGCCACGG
CTGCATCCTAGACCAAGACTCTCCTCGACTCTACGAGCTTGTACACGGGTTTTTCGAGGATGGTCCCGAAGAAACATTCT
ACGACTCTGACTCCAAACTGTCTGAGAATTCTGTAGTTGAATGTCCCAGCGAAGATAGTGAGGAGATCCTGAGGATGGCG
GTGAGCTTATCCGATTCCGATCCTTACCAGAATCTATTGTTAGCTCACGTTTTGAGAGCTGTGGAGGCATACTCCGGTTT
TAGGTCAAGGAATAAATCTGTTTTCGGGGACAAGGTAGTTTCGTTTCTACGAGAGCTCGGCTACAACGCCGCGGTTTGTG
TATCAAAATGGACTTCATCGGCCAAACTCATCGCCGGGAGTTACCAATTCATTGACGTCGTTTACAAGCCGTCAGATAAT
GATCAGACGGCCGTCCGTTACTTCGTTGATCTAGACTTTGCTTCGGAGTTCGAGATCGCAAGGCCAACACGCGAATACAC
ACGTGTGTTGCAGTTGCTGCCTAACGTTTTCGTAGGAAAAGAAGAGAATCTGAGGACGATCGTGAGAGAGTCATGTGACG
CAGCGAAGAGGTCGTTGAAGAGCCGTGGCTTGTCTCTCCCACCGTGGCGGAGAAGCTCTTATTTGCAACACAAGTGGTTT
AGTCCGTATAAAAGAAAGGTGGGATCTAGTTTGGGAGTGAAGCCGTTGAATAGTGACGCCGTTAGCTGCCGCTCTTTAGG
GTATGATGACGGCGCCGTCAATACTCGTTTGTTCATTAGGGCATGA