Details for Lyrate rockcress Locus 16037847

Position : sca3 ( 5`- 12287622 .. 12289815 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479998 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037847

Protein [Map View]
MAQPMNDITVKNNESHEEEIPDQFLCCVCLELLYKPIVLSCGHLSCFWCVHKSMNGFRESHCPICRDPYVHFPSVCQKLY
FLLKKMYPLAHKKREEQVLKEEQELDCFSPQIDVVLEETKVKDVSVCSGDSLNVSDKQKVDECSNAANLLSSSSSRGGSP
CIPSNQEPTDAQTLNVHENELPKNNKVSNQISKDDLLCSACKELLVRPVVLNCGHVYCEGCVVDMAEESEKIKCLECNVC
DPRGFPKVCLILEQLLEENFPEEHKSRTSGIQKRLAHNSKGNFQSHLKEGPSLSNDNNDDLPWLANPGSNVHFEAGCDSC
GVYPIIGDRYRCKDCKEEIGYDLCKDCYETPSKVPGRFNQQHTPDHRLELARAPQVLINFNSIGILLGPSDISTEAMDTD
EGEEGPRGSSNESSSTE*

DNA
ATGGCCCAACCTATGAACGATATTACGGTGAAGAACAATGAATCACACGAAGAAGAAATCCCCGATCAATTTCTCTGCTG
CGTTTGCCTGGAACTTCTTTACAAGCCAATTGTGTTATCTTGTGGTCATCTATCATGTTTTTGGTGTGTACATAAGTCCA
TGAATGGCTTTCGCGAGTCTCATTGTCCGATATGTAGAGACCCGTATGTTCACTTTCCGTCTGTGTGCCAGAAGCTTTAT
TTTCTACTGAAGAAGATGTACCCATTAGCGCATAAGAAGAGAGAAGAACAAGTTCTAAAGGAAGAACAAGAACTAGATTG
TTTTTCTCCTCAGATTGATGTTGTTTTGGAGGAAACAAAGGTTAAGGATGTGTCTGTATGTAGTGGAGATTCTCTAAATG
TCTCTGATAAACAGAAGGTGGATGAGTGTTCGAATGCAGCGAACTTATTATCTAGTTCATCAAGTAGAGGTGGCAGTCCA
TGTATCCCCAGCAATCAAGAACCCACTGATGCACAAACTCTTAATGTTCATGAGAATGAATTACCTAAGAATAACAAAGT
CAGTAATCAGATTTCGAAAGATGATTTGCTCTGTTCAGCATGTAAGGAGCTACTTGTGCGACCCGTAGTTCTCAATTGCG
GACATGTCTATTGTGAAGGATGTGTAGTAGATATGGCTGAAGAAAGCGAAAAGATCAAATGTCTAGAGTGTAATGTTTGT
GACCCTAGAGGATTTCCAAAAGTTTGTTTGATTCTTGAACAGCTTTTGGAGGAAAATTTTCCTGAAGAACACAAATCAAG
GACAAGTGGGATTCAGAAAAGGCTTGCCCATAATAGCAAAGGAAATTTTCAAAGCCATCTAAAAGAAGGCCCATCGTTAT
CAAACGACAACAACGATGATCTTCCCTGGTTGGCAAACCCTGGATCAAATGTTCACTTTGAAGCTGGTTGTGATTCTTGT
GGAGTGTATCCAATCATAGGGGATCGATACAGATGCAAAGACTGCAAGGAGGAAATTGGGTATGACCTTTGCAAAGACTG
TTACGAGACTCCTTCAAAAGTTCCAGGGAGATTCAACCAGCAGCACACTCCTGACCACAGGCTTGAGCTCGCGAGGGCTC
CTCAGGTTCTGATCAATTTCAATTCTATCGGTATCCTTCTCGGACCCTCGGATATCTCAACTGAAGCCATGGATACAGAT
GAGGGCGAGGAAGGGCCTCGGGGTTCTTCTAATGAGTCATCAAGCACAGAATGA