Details for Lyrate rockcress Locus 16037842

Position : sca3 ( 5`- 2979138 .. 2980720 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037842

Protein [Map View]
MSTKLWRWVLGLMYLFAVATIWIAASFVVQSVVEAGVSPFLITFICNSLFVVYLPLFEIGRYLEDAYGSLLFWRSKRSHL
MELVESEKAVLLGQDVSGVKSDATESSSGLVVREEEISEGGNGIESGLENVELEINGSVNVSDGASGVSNKGLDEKGRWT
RMRVAKVSLVICPFWFLAQLTFNVSLKYTTVTSNTILSSASSLFTFLVSLIFLGEKFTWLKLFSVLLCMSGTIIVSMGDS
ESNSNAVAKNPLLGDILSLVSAALYAVYITLIRKKLPDDDERNGRVSMAQFLGFLGLFNFFIFLPPALILNFTKRERFNT
LTLKQFGLVVGKGLLDNVLSDYLWAKAVLLTTTTVATAGLTIQVPLAAIVDSLSGNKPSFTDYIGAAAVMVGFAGINIPS
EMFCKSKETAIELEPGTSFTDPPPIVPDSIRVDSSLTVV*

DNA
ATGTCAACAAAGTTATGGAGATGGGTATTAGGGTTGATGTACCTATTTGCCGTTGCCACGATTTGGATTGCAGCCAGTTT
TGTAGTTCAGTCTGTGGTAGAAGCTGGTGTTTCTCCGTTCTTGATCACTTTCATCTGTAATTCATTGTTCGTTGTTTATC
TTCCCCTTTTTGAGATTGGTCGATATCTTGAAGATGCATATGGGAGTTTATTGTTTTGGAGAAGCAAAAGGTCGCATTTA
ATGGAATTGGTCGAATCTGAGAAGGCTGTTTTGCTTGGACAAGATGTTTCAGGTGTGAAATCAGATGCTACTGAGAGTTC
TTCAGGGCTTGTTGTGAGAGAGGAAGAGATTAGTGAGGGTGGTAATGGAATTGAATCTGGATTGGAAAATGTAGAGCTTG
AGATTAATGGTAGTGTCAATGTTAGTGATGGAGCTAGTGGAGTTTCTAATAAAGGATTAGATGAGAAGGGACGTTGGACA
CGGATGCGAGTTGCTAAAGTTAGCCTTGTGATTTGCCCGTTTTGGTTTTTGGCACAGCTTACTTTTAATGTCTCTCTCAA
GTACACGACAGTTACGTCAAATACCATCTTAAGCAGTGCATCAAGCCTTTTCACCTTTCTTGTTTCACTAATATTCTTGG
GTGAAAAGTTCACGTGGTTGAAACTCTTCAGCGTTCTTCTTTGTATGTCTGGGACCATCATTGTAAGTATGGGTGACTCA
GAATCCAACTCAAATGCAGTAGCTAAAAACCCTCTTTTGGGAGATATTCTTTCACTGGTCTCAGCTGCGCTATATGCTGT
CTACATCACTCTTATACGCAAAAAGCTTCCAGATGATGATGAAAGAAACGGCCGTGTCAGTATGGCTCAGTTCCTGGGCT
TTCTTGGTCTCTTCAATTTCTTCATTTTCCTTCCTCCTGCTCTAATACTCAACTTCACAAAGCGAGAACGCTTCAACACA
CTAACCTTGAAACAATTTGGTTTAGTTGTTGGCAAAGGTTTGTTAGATAATGTGCTTAGTGACTATCTGTGGGCAAAGGC
AGTCCTATTGACAACAACCACTGTAGCTACGGCTGGGCTAACCATTCAGGTTCCATTGGCAGCCATTGTAGACAGCTTAT
CAGGGAACAAACCAAGCTTCACCGACTACATTGGTGCTGCAGCTGTTATGGTTGGCTTTGCAGGGATCAATATTCCCTCA
GAGATGTTTTGCAAATCCAAAGAGACTGCTATTGAGTTAGAACCTGGGACTTCGTTCACAGATCCTCCTCCGATTGTGCC
GGATAGCATAAGAGTAGATTCTTCATTGACTGTAGTATAA