Details for Lyrate rockcress Locus 16037838

Position : sca3 ( 5`- 11125842 .. 11119529 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898924 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037838

Protein [Map View]
MASPSLGASILVSHCSSVPEFQVSGMRLVFGYKGFGRRTSRKGFRVRCESKIQEKELRRCSPFLERLSLPREAALGSNEW
KAVPDIWRSSVEKYGDRVAVVDPYHDPPSTFTYRQLEQEILDFVEGLRVVGVKADEKIALFADNSCRWLVADQGIMATGA
VNVVRGSRSSVEELLQIYCHSESVALVVDNPEFFNRIAESFSCKAAPKFVILLWGEKSSLVTAGMPTPVYSYNEIKNFGQ
ERRAKFARSNDAGKYEYEFIDPDDIATIMYTSGTTGNPKGVMLTHQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERA
CEYFIFTCGVEQKYTSIRFLKGDLKQYQPHYLISVPLVYETLYSGIQKQISTSSPVRKFLALTLIKVSLAYTEMKRIYEG
LCLTKNQKPPLYIVSLVDWLWARVVAFVLWPLHILAEKLVHKKIRSSIGITKAGVSGGGSLPMHVDKFFEAISVNVQNGY
GLTETSPVVSARRLRCNVLGSVGHPIKDTEFKIVDHETGTVLPPGSKGIVKVRGPPVMKGYYKNPLATKQVIDDDGWFNT
GDMGWITPQHSTGRSRSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIVIPNKEAAE
GAAKQKISPVDPEVNELSKERITSMVYEELKKWTSQCSFQVGPVLIVDEPFTIDNGLMTPTMKIRRDKVVDQYKNEIDRL
YK*

DNA
ATGGCTTCACCGTCTCTGGGAGCTTCGATTCTCGTTTCTCACTGCTCCTCTGTTCCTGAATTTCAAGTTTCTGGGATGAG
ATTGGTGTTTGGTTACAAGGGTTTTGGTCGCAGAACTTCACGCAAGGGATTTCGAGTTCGCTGCGAGTCCAAGATTCAGG
AGAAGGAGTTAAGGCGGTGCTCGCCATTCTTGGAACGCTTATCATTGCCAAGGGAGGCTGCTTTGGGCTCTAATGAATGG
AAGGCTGTTCCTGATATTTGGAGATCATCTGTGGAGAAGTACGGTGACAGAGTTGCGGTGGTGGATCCGTATCATGACCC
ACCTTCTACATTCACTTACAGACAGTTGGAACAAGAAATCTTGGACTTTGTTGAGGGTTTGCGAGTTGTTGGAGTGAAAG
CTGATGAGAAGATTGCACTTTTTGCTGATAACTCCTGTCGGTGGCTTGTTGCTGATCAAGGTATAATGGCCACAGGAGCA
GTCAATGTTGTTAGAGGATCCAGATCCTCTGTTGAAGAATTATTGCAGATTTACTGTCATTCGGAAAGTGTAGCCCTTGT
TGTGGATAACCCTGAGTTTTTCAACCGCATTGCTGAGTCATTTTCTTGCAAGGCGGCTCCAAAATTTGTGATTCTTCTCT
GGGGGGAAAAATCGTCGTTGGTTACAGCGGGTATGCCCACACCAGTCTATAGTTACAATGAAATTAAAAATTTTGGACAA
GAGAGACGTGCAAAATTTGCAAGATCTAATGATGCTGGGAAGTATGAATATGAATTCATCGATCCAGATGATATAGCCAC
AATTATGTATACCAGCGGAACCACTGGAAATCCAAAAGGTGTTATGCTCACACATCAGAATTTGTTACACCAGATAAGAA
ATTTATCTGACTTTGTGCCTGCGGAAGCTGGGGAAAGATTTCTGAGTATGTTGCCATCATGGCATGCCTATGAACGGGCT
TGTGAATACTTCATATTTACATGTGGAGTTGAGCAAAAGTATACGTCTATAAGATTCTTAAAGGGTGATCTCAAGCAGTA
TCAACCACACTATCTTATTTCAGTACCTTTAGTATATGAGACACTCTACAGCGGGATTCAAAAGCAAATTTCGACAAGCT
CCCCTGTTCGTAAATTTTTAGCGCTTACATTGATCAAAGTCAGCCTAGCATATACTGAGATGAAAAGAATTTATGAGGGT
CTTTGTTTGACAAAAAATCAAAAGCCTCCATTGTATATTGTTTCGTTGGTGGATTGGTTGTGGGCGAGAGTAGTTGCGTT
TGTCCTTTGGCCACTGCATATCTTAGCTGAAAAGCTTGTGCACAAAAAAATTCGTTCGTCTATTGGGATAACAAAGGCTG
GTGTTAGTGGAGGCGGTAGTCTACCTATGCATGTTGACAAGTTCTTCGAGGCCATCAGTGTGAATGTACAAAATGGGTAT
GGTTTGACAGAAACCTCACCGGTTGTCTCGGCGCGGAGGCTTAGGTGTAATGTGCTTGGCTCAGTTGGGCATCCTATTAA
AGATACAGAATTCAAAATTGTAGATCATGAGACTGGTACTGTTCTTCCACCTGGTTCAAAGGGCATTGTCAAAGTCAGAG
GCCCACCGGTGATGAAAGGTTACTACAAGAATCCGCTGGCCACCAAGCAAGTTATAGATGACGATGGATGGTTCAATACT
GGGGATATGGGTTGGATTACTCCTCAGCATTCAACAGGACGGAGTCGTAGCTGTGGAGGTGTCATCGTTCTTGAAGGCCG
TGCCAAGGACACAATCGTGCTTTCCACAGGTGAAAATGTGGAACCATTGGAGATTGAAGAAGCGGCCATGAGAAGCAATT
TGATACAGCAAATAGTGGTTATTGGACAGGATCAACGCCGCCTTGGAGCTATTGTTATCCCAAACAAAGAAGCAGCAGAA
GGAGCAGCAAAGCAGAAAATTTCACCTGTAGATCCTGAAGTCAACGAACTTAGCAAGGAGAGGATAACGAGCATGGTCTA
CGAAGAACTGAAGAAATGGACATCACAATGCTCGTTCCAAGTTGGACCGGTTCTGATCGTGGATGAGCCCTTCACGATAG
ACAACGGTTTGATGACACCGACAATGAAAATAAGACGGGACAAGGTGGTTGATCAATACAAGAACGAGATAGATAGACTC
TACAAGTAG