Details for Lyrate rockcress Locus 16037819

Position : sca3 ( 5`- 6740756 .. 6741389 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037819

Protein [Map View]
MSSKQGGKLKPLKQPKSGKKEYDEHDMELMQKKKDEEKALKELRAKASQKGSFGGTGLKKSGKK*

DNA
ATGTCGTCCAAGCAAGGAGGGAAATTGAAGCCTTTGAAGCAGCCTAAGTCTGGTAAGAAGGAGTACGATGAGCACGATAT
GGAGTTAATGCAGAAAAAGAAGGATGAAGAGAAGGCACTTAAAGAACTCAGGGCCAAGGCTTCACAAAAGGGATCATTCG
GAGGCACAGGACTTAAGAAGAGTGGAAAGAAATAA