Details for Lyrate rockcress Locus 16037814

Position : sca3 ( 5`- 7384255 .. 7383111 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037814

Protein [Map View]
MTKISDLPRDLAEEVLSRVPVTSLRAVRFTCKKWNTLTKHRSFTKKLVCQAKAEPKKKQAKEFHAIMTMNYKVYLMSVNL
DEIHKDDNVESSIKQKGKLISLNVADRISISQVCHCDGLLLCITNDNSRLVVWNPYSGQTRRVQPRISYKRWDYYKYALG
YEMNNNSYRSHKILRFTPTMGDVEVTPDWTIDQHGVSLKGNTYWSSLRQKSLHFEILEEIPGFLLCFDFTTEKFGPHLPL
PFKYPFREDTITLSIVGEEQLAVLGQHQHWTEIWISNKIEPNAVSWSKLFLIVDEIRLDPARAATFFVDEEENVAVSSRN
TANIVGVDGYDKEADLGESVHKYCFPLVCSYVPSSVQI*

DNA
ATGACGAAGATTTCCGATCTTCCTAGGGATTTGGCAGAGGAGGTGCTCTCTAGGGTTCCAGTTACATCTCTGAGAGCAGT
ACGATTTACTTGCAAAAAGTGGAACACTTTAACTAAACATCGGAGCTTTACAAAGAAGCTGGTTTGTCAAGCAAAAGCAG
AACCAAAGAAGAAGCAGGCGAAGGAGTTTCATGCGATCATGACGATGAATTATAAGGTTTATCTGATGAGCGTCAATCTA
GATGAAATTCACAAAGATGACAACGTTGAATCATCTATAAAGCAGAAAGGTAAACTTATTAGCCTAAACGTTGCTGATCG
AATAAGTATATCTCAAGTTTGTCACTGTGATGGTTTGTTGTTATGCATCACCAATGACAACTCTAGGCTTGTGGTTTGGA
ACCCTTATTCTGGGCAAACAAGAAGGGTCCAACCTCGAATTTCTTACAAGAGATGGGACTACTACAAGTATGCTCTCGGG
TACGAGATGAATAACAACTCTTATCGTAGCCACAAAATTTTGAGATTTACACCCACTATGGGAGATGTTGAGGTCACCCC
CGACTGGACTATAGATCAACATGGCGTGTCTCTCAAGGGTAATACTTACTGGTCTTCTCTAAGACAGAAGAGCTTACATT
TTGAGATATTAGAAGAGATCCCTGGTTTTTTACTATGTTTTGATTTTACAACAGAGAAATTTGGACCGCATCTGCCTCTG
CCATTTAAGTACCCTTTTAGAGAAGATACTATAACTCTATCTATTGTTGGAGAAGAGCAACTTGCAGTGTTAGGTCAGCA
TCAACATTGGACAGAGATATGGATTAGTAATAAGATTGAGCCAAATGCGGTGTCATGGAGCAAATTGTTTTTAATAGTAG
ATGAGATAAGACTAGACCCGGCTAGAGCTGCGACTTTCTTCGTTGATGAGGAGGAGAATGTGGCCGTGTCCAGTCGCAAC
ACAGCCAACATCGTTGGAGTGGATGGATACGACAAAGAAGCGGATCTCGGAGAATCTGTCCACAAATATTGTTTTCCACT
TGTGTGCTCTTATGTTCCGAGTTCAGTGCAAATCTAG