Details for Lyrate rockcress Locus 16037791

Position : sca3 ( 5`- 3647556 .. 3646571 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317721 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037791

Protein [Map View]
MEQQVFDKSVALFGDSKLVNVSSSIQLTDSVSQSEGRVFYRKPIHLFKGKERNSVIFSTYFSFSMPNEIGDVLAFVMVPS
SLDLSLFGKKDYSSSALGFLLEYAKNETVVAFEFDISKRGNRARILIGRPESAKIRNLSFVGDLMMNNGGTLNCMIEYEA
SSKRMMVRFRKPGSIKLLDPFFSFSVDLEKTWKGGEVMVGLSSANGNSSKPHFLYSWSFEIRHLDPIWVQPTPFGPNEGL
KPDVSTEVEEGRERSECIWRMLGTLVLGAVCGALGAMSAMYLWTICGVRRSMAVVPEECAVSIVVVAVKDGKK*

DNA
ATGGAACAGCAGGTTTTTGACAAGAGTGTTGCTCTGTTTGGAGATTCCAAGCTGGTCAATGTCAGTTCTTCGATTCAGCT
GACTGACTCAGTGAGTCAGAGCGAGGGACGAGTCTTTTATAGGAAACCCATCCATCTATTCAAAGGTAAAGAGAGGAACT
CGGTTATTTTCTCGACTTACTTCTCTTTTTCGATGCCCAATGAGATTGGTGATGTCTTGGCTTTTGTAATGGTTCCAAGT
TCTTTGGATCTTAGTCTGTTTGGTAAGAAAGATTACAGTTCCTCTGCTTTAGGGTTTCTACTAGAGTATGCAAAGAACGA
GACAGTTGTTGCTTTTGAGTTTGATATCTCCAAGAGAGGAAACCGTGCAAGAATCTTAATTGGTAGACCTGAATCTGCTA
AAATTAGAAACCTTTCGTTTGTTGGTGACTTGATGATGAACAATGGAGGGACTTTGAACTGTATGATTGAGTATGAGGCA
AGTTCTAAGAGAATGATGGTTCGATTCAGAAAACCTGGTTCGATAAAGCTGTTGGATCCGTTCTTCTCATTCTCGGTAGA
CTTGGAGAAGACTTGGAAAGGTGGTGAAGTCATGGTGGGTTTAAGCTCTGCTAATGGGAACTCTTCCAAGCCACATTTTC
TCTATTCATGGAGCTTTGAAATAAGGCATCTTGATCCGATATGGGTGCAACCAACGCCATTTGGACCGAATGAAGGTTTG
AAGCCGGACGTTTCCACGGAAGTGGAAGAGGGCCGAGAGAGAAGTGAGTGTATATGGAGAATGCTTGGTACTTTGGTCTT
GGGTGCAGTATGTGGAGCCTTAGGGGCAATGTCAGCTATGTATCTTTGGACAATATGCGGTGTTAGGAGGTCAATGGCCG
TGGTTCCAGAGGAATGTGCCGTGAGCATTGTGGTCGTTGCTGTTAAAGATGGCAAGAAGTAG