Details for Lyrate rockcress Locus 16037790

Position : sca3 ( 5`- 2318185 .. 2316172 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037790

Protein [Map View]
MADLLPIYLIIVAFLCTVGAIALALFHIYKHLLNYTEPIYQRYIVRIVFMVPVYALMSFLALVLPKSSIYFNSIREVYEA
WVIYNFLSLCLAWVGGPGSVVISLTGRSLKPSWHLMTCCFPPLPLDGRFIRRCKQGCLQFVILKPILVAVTLVLYAKGKY
KDGNFSPDQSYLYLTIIYTISYTVALYALVLFYVACKDLLQPFNPVPKFVIIKSVVFLTYWQGVLVFLFAKSGFIRDEEE
AALFQNFIICVEMLIAAAAHFYAFPYKEYAEANVGGARSFSGSLAHALMLNDFYHDTVHQFAPTYHDYVLYNHNDGGEEG
TRKYRARTFVPTGQEMDAVRKNKHMFGNKIDGVSVSSQSSETSTPKTSGDPARPESMKSSLLVDASDSVSTMYDMSLIDI
DISSYPSKVPFANISGGPK*

DNA
ATGGCGGATTTGCTACCCATTTACCTCATTATCGTAGCATTTCTATGCACTGTCGGAGCCATTGCTTTGGCTTTGTTTCA
TATCTACAAGCACCTATTGAACTATACGGAACCCATTTATCAGAGATATATTGTGCGCATCGTCTTCATGGTCCCGGTCT
ATGCCTTGATGTCATTCTTGGCTCTCGTTTTGCCCAAGAGCTCTATATATTTTAACTCTATCCGTGAAGTTTATGAAGCA
TGGGTGATTTATAATTTTCTATCGCTGTGTTTGGCATGGGTTGGAGGCCCAGGTTCAGTAGTTATAAGTTTAACTGGTCG
ATCTCTGAAGCCATCGTGGCATCTCATGACATGTTGCTTCCCTCCACTACCATTAGACGGGCGTTTTATTCGACGGTGCA
AGCAAGGTTGTTTGCAATTTGTTATTCTAAAGCCAATCCTAGTTGCTGTCACACTTGTGCTTTATGCAAAAGGGAAATAC
AAGGATGGAAATTTCAGCCCTGACCAATCCTATCTCTATCTTACCATCATCTATACAATATCATACACAGTAGCTTTGTA
CGCGCTGGTCCTCTTTTATGTGGCATGCAAAGATCTGCTTCAGCCATTCAATCCAGTCCCAAAATTTGTGATTATAAAGT
CTGTCGTCTTTCTAACCTATTGGCAGGGTGTTCTAGTTTTCCTTTTTGCTAAATCTGGATTTATAAGGGATGAAGAAGAA
GCAGCGCTCTTCCAAAATTTTATAATATGTGTGGAAATGCTTATTGCTGCAGCTGCTCATTTCTATGCATTTCCGTACAA
GGAATATGCAGAGGCCAATGTTGGAGGAGCTCGCAGTTTCTCAGGAAGTCTGGCACATGCTCTTATGCTAAATGATTTCT
ACCATGATACTGTTCACCAGTTTGCCCCAACATATCACGATTATGTGCTCTATAATCATAATGATGGTGGTGAGGAAGGG
ACAAGGAAGTACCGAGCACGAACATTTGTGCCAACTGGTCAGGAAATGGATGCTGTCAGAAAGAACAAACACATGTTTGG
AAACAAGATAGATGGTGTTTCGGTCTCTAGTCAATCTTCAGAAACAAGCACACCCAAAACCTCTGGTGATCCTGCACGCC
CTGAGAGCATGAAATCTTCCTTGCTGGTAGATGCCTCAGACTCGGTTTCCACAATGTATGACATGTCGCTAATTGACATC
GATATATCGAGCTACCCAAGCAAGGTACCTTTTGCAAATATAAGTGGAGGACCTAAATAG