Details for Lyrate rockcress Locus 16037733

Position : sca3 ( 5`- 5062340 .. 5061621 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037733

Protein [Map View]
MMISRRLVSKFLKPLSSPSFHASCRHLQSSSSLIRNHLTHGSVTQELGLLRSFSAFNIDKLRSETWSPRYFSTPSGETEP
KKPAEESKPEELPKMKHQEIEGPTVERDLSALGNETRQVLEGMMKNMYSLSGAMGALGLTQLILGGAILYATRSDPMKEM
TIQSCIAFGFPFAMALMVRRSLKPMYFFKKMEELGRLQILTLTLQVAKNLNLLFVRARVVSILCVVALCFGNLFLLLSP*

DNA
ATGATGATCTCTCGTCGATTGGTTTCGAAATTCCTTAAACCCTTGTCTTCTCCATCTTTCCACGCTTCTTGCCGTCATCT
CCAATCTTCCTCATCTCTCATAAGAAACCATCTGACCCACGGATCAGTAACTCAGGAGCTTGGTCTCTTAAGATCCTTTT
CTGCTTTCAATATCGACAAGCTTCGATCTGAAACATGGTCACCGAGGTATTTCTCGACACCAAGCGGAGAGACCGAGCCG
AAGAAGCCAGCAGAGGAGTCGAAGCCAGAGGAGCTGCCGAAGATGAAGCACCAGGAGATCGAAGGACCAACAGTGGAACG
CGATTTGTCGGCGTTAGGAAATGAGACGAGACAAGTGTTGGAAGGGATGATGAAGAACATGTACAGTCTAAGTGGAGCCA
TGGGTGCTCTTGGTTTAACTCAATTGATTCTTGGAGGGGCGATTTTGTACGCGACTCGATCAGATCCGATGAAGGAAATG
ACAATTCAGAGCTGTATAGCTTTCGGATTCCCGTTTGCGATGGCGTTGATGGTGAGACGATCGTTGAAGCCAATGTACTT
CTTCAAGAAGATGGAAGAGTTAGGTAGGTTGCAGATTCTAACTTTGACACTTCAAGTTGCTAAGAATCTCAATTTGTTGT
TCGTTAGGGCTCGTGTTGTTTCCATCTTGTGTGTTGTTGCCTTGTGTTTCGGAAACTTGTTCCTCTTGTTATCACCATGA