Details for Lyrate rockcress Locus 16037690

Position : sca3 ( 5`- 9141731 .. 9138385 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037690

Protein [Map View]
MSKITLGNESIVGSLTPSNKKSYKVTNRIQEVKKPLYAVVFNFLDARFFDVFVTAGGNRITLYNCLGDGAISALQSYADE
DKEESFYTVSWACGVNGNPYVAAGGVKGIIRVIDVNTETIHKSLVGHGDSVNEIRTQPLKPQLVITASKDESVRLWNVET
GICILIFAGAGGHRYEVLSVDFHPSDIYRFASCGMDTTVKIWSMKEFWTYVEKSFTWTDDPSKFPTKFVQFPVFTASVHT
NYVDCNRWFGDFILSKSVDNEILLWEPQLKENSPGEGTSDVLLRYPVPMCDIWFIKFSCDLHLSSVAIGNQDGKIYVWDL
KSCPPVLITKLSHNQSKSVIRQTAMSVDGSTILACCEDGTIWRWDVITK*

DNA
ATGTCGAAGATAACGTTAGGGAACGAGTCAATTGTTGGGTCTTTGACTCCATCGAACAAGAAATCGTACAAAGTGACGAA
TAGGATTCAAGAAGTTAAGAAACCTTTGTATGCTGTTGTTTTCAACTTCCTTGATGCTCGTTTCTTCGATGTCTTCGTTA
CCGCTGGTGGTAATCGGATTACTCTGTACAATTGTCTCGGAGATGGTGCCATATCAGCATTGCAATCCTATGCTGATGAA
GATAAGGAAGAGTCGTTTTACACTGTAAGTTGGGCGTGTGGCGTTAATGGGAACCCATATGTTGCGGCTGGAGGAGTAAA
AGGCATAATCCGAGTCATTGACGTCAACACTGAAACGATTCATAAGAGTCTTGTGGGTCATGGAGATTCAGTGAACGAAA
TCAGGACACAACCTTTGAAACCTCAACTTGTGATTACTGCTAGCAAGGATGAATCTGTTCGTTTGTGGAATGTTGAAACT
GGGATATGTATTCTGATATTTGCTGGAGCTGGAGGTCATCGCTATGAAGTTCTAAGTGTGGATTTTCATCCCTCTGATAT
TTACCGCTTTGCTAGTTGTGGTATGGACACCACTGTTAAAATATGGTCGATGAAAGAGTTTTGGACATACGTCGAGAAGT
CGTTCACATGGACTGATGATCCATCAAAATTCCCCACAAAATTTGTCCAATTCCCTGTATTTACAGCTTCGGTTCATACA
AATTATGTAGATTGTAACCGTTGGTTTGGTGATTTTATCCTCTCAAAGAGTGTGGACAACGAGATTCTGTTGTGGGAACC
ACAACTGAAAGAGAATTCTCCAGGAGAGGGAACTTCAGATGTTCTACTAAGATACCCGGTTCCAATGTGTGATATTTGGT
TTATCAAGTTTTCTTGTGACCTCCATTTAAGTTCTGTTGCGATAGGTAATCAGGACGGAAAGATTTATGTCTGGGATTTA
AAAAGTTGCCCTCCTGTTTTGATTACAAAGTTATCACACAATCAATCAAAGTCTGTAATCAGGCAAACCGCCATGTCTGT
CGATGGAAGCACAATTCTTGCTTGCTGCGAGGACGGGACTATATGGCGCTGGGACGTGATTACCAAGTAG