Details for Lyrate rockcress Locus 16037422

Position : sca3 ( 5`- 6562165 .. 6560732 -3` )
Annotation : [B2G] phototropic-responsive nph3 family protein
External links : CoGe
PGDD synteny : 16037422

Protein [Map View]
MKKTPSPEPVTIYGNQQETFVGDMEYYTYFDESCIQDMNYFVKTITGIKSKGIRPDLIGSIIAHYASKWLPDLSGNVSAI
ISTSVESKNHLNDTQPESVTASVMKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMVGANTNYLTELETRVSWQLDQA
SLKELMIPSFSYTSGTLLDVELVTRLVNKFSGLDSEGVKTSAALVKVAKLVDSYLAEAAVDGALALPEFISLITALPSHA
RTTEDGLYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIRVLFTEQTKLSRHIDWNGSSIS
STTKSPTNPSGSHYLEGGSAARCLSKREMNVQQAEIRRLREDVVRLQSQCSAMHLQVERLMEKKSSGGSKGFFRWKRLGL
VPSIRGSVSVEKGEEESGDGEGFEPRTPGNMKTRLVKGRTTPSRWRKSMS*

DNA
ATGAAGAAAACACCTTCGCCGGAACCAGTCACCATCTACGGCAATCAGCAAGAAACCTTCGTCGGAGATATGGAGTACTA
CACTTACTTCGACGAATCTTGTATCCAAGACATGAACTATTTCGTCAAAACAATCACCGGAATCAAATCCAAAGGAATCA
GACCAGACCTTATCGGTTCCATCATCGCTCATTATGCTTCAAAATGGCTCCCTGATCTCTCCGGCAACGTCTCCGCCATC
ATTTCAACCTCCGTGGAATCCAAGAACCACCTCAATGACACACAGCCGGAGAGCGTCACTGCATCTGTAATGAAGAAACG
ATTTTTCGTCGAAACACTAATCGGAATCCTCCCGCCGGAGAAAGACTCTGTTCCTTGCAATTTCCTCCTCCGTCTCCTCA
GGACAGCGAAAATGGTCGGAGCTAATACGAACTACTTAACGGAGCTTGAAACCAGAGTCTCGTGGCAGCTTGACCAAGCC
TCTCTCAAGGAGCTTATGATACCTTCCTTCAGCTACACGTCTGGTACTTTGCTTGACGTTGAGCTTGTGACGCGTCTCGT
GAACAAGTTTTCTGGATTGGATAGTGAAGGTGTTAAAACCAGTGCGGCTCTTGTTAAAGTGGCCAAGCTTGTTGACTCTT
ATCTCGCTGAAGCCGCCGTTGACGGTGCTTTGGCTTTACCGGAGTTTATTTCCTTAATCACAGCTCTTCCTAGCCATGCT
CGTACTACAGAGGACGGCTTGTACCGCGCCATTGATACATATCTCAAGGCACATCCTCAGGTGTTGAAGCAAGAAAGGAA
GGAACTTTGCAGACTTATTGATAGCAGAAAGTTATCACCGGAAGCAGCTCTTCACGCGGCTCAGAATGATCGTTTACCGG
TGAGAGCAATCATTAGAGTTTTGTTCACTGAGCAGACAAAGCTAAGTCGTCACATTGACTGGAATGGTAGCTCTATAAGC
AGCACGACGAAGAGTCCAACAAACCCTTCTGGTTCACATTACTTGGAGGGAGGTTCTGCAGCGCGGTGCTTGTCTAAACG
TGAGATGAATGTTCAGCAAGCAGAGATAAGAAGGCTTAGAGAAGATGTGGTGAGGCTGCAGAGCCAGTGTAGTGCTATGC
ATTTGCAGGTGGAGAGGCTTATGGAAAAGAAGAGTAGTGGTGGAAGTAAAGGGTTTTTCCGGTGGAAGAGGCTCGGGTTA
GTACCGTCAATTCGAGGAAGTGTTAGCGTTGAAAAAGGTGAGGAAGAATCTGGTGATGGTGAAGGATTTGAGCCTCGGAC
TCCTGGGAATATGAAGACAAGGCTTGTCAAAGGAAGAACGACACCTTCAAGGTGGAGAAAATCTATGTCTTAA