Details for Lyrate rockcress Locus 16037412

Position : sca3 ( 5`- 3899338 .. 3897005 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478310 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037412

Protein [Map View]
MRGGGRRRSNGGGGSGKSKARSPGQSTRTNHNSAAGSSSGGRRRRQNNTTLFVEGGILSDYRKDPNFSTPSRGGSSSGKG
LKYGSTDRVKASASMSGPRKCSGNTYVYQYPSIDFEQGLERKAGVDRDQMDGSIPIVLGKSEATQVVAFLDQTPSSSKGI
KVSYDYEYEPSFVLGDDSHRGLGFCDDSDATPSGSLSIPKALGDQGGSFSPEEEVDAVEESGGNDDEVMPDVVKTPKRRN
SGFISIGGMKLYTEDISGEESDGEEEMDDDESGDEGSNGFSESSESDSSEDMFGSNSEIDDAVAKDYLEGIGGSEIMLDA
HWLAEQSLDKLDLSSDDSSSSDSSDRKTRKLTGIGLRKASMEYGKKKTTRSRFSGHGKSTNPLTMDDLMFVKDPRSLSGK
KNKKKEVAKFPHSWPSGAPKSKNSRNFPGEKKKHRKEYIALKRRERMLQRGVDLADINSQLESFVLENVDMHCFQRMHNR
DCSQVRRLADVYRLSSSCNGSGKKSFVTVTRTYQTCMPSASDKLRIEKLIGAGDEDYDFAVSGEVKGKSGSLDRKKAKDS
AKKRTTREEQERNKSNGKKSSYADQPVSFVSSGIIDSEIAVGKTLGEKDAKQVAESTPGTSNGADIGAFEVHTRGFGSKM
MAKMGFIDGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFNIDTEDPTPSSNNNAKRNRSSSSGKHVKRISHENGASGSGGI
RDKRLGAFEQHTTGFGSRMMARMGFVEGSGLGRESQGIVNPLVAVRRPRARGIGAEG*

DNA
ATGCGAGGCGGTGGTAGGAGAAGATCTAACGGTGGTGGTGGTTCTGGGAAAAGCAAGGCTAGATCTCCAGGACAAAGCAC
GAGAACCAATCATAATTCCGCGGCGGGATCTTCCTCCGGTGGTCGTCGCCGACGTCAGAATAATACTACTTTGTTTGTCG
AAGGAGGTATTCTCTCCGATTACCGAAAAGATCCTAACTTTTCTACGCCATCTCGTGGAGGAAGCTCTTCGGGAAAGGGA
TTGAAATATGGAAGCACAGATCGCGTAAAAGCTTCTGCTTCCATGAGTGGTCCAAGGAAATGCAGTGGTAATACTTATGT
GTATCAGTATCCTTCCATTGATTTTGAGCAAGGGTTAGAGCGAAAAGCAGGCGTTGACAGGGATCAAATGGATGGTTCAA
TTCCTATTGTGTTGGGGAAGTCAGAGGCGACTCAAGTTGTTGCATTTCTGGATCAAACGCCTTCGTCATCGAAAGGGATT
AAGGTAAGTTATGATTACGAATACGAACCGAGTTTTGTTTTGGGTGATGATTCCCATAGAGGATTGGGATTTTGTGATGA
TTCTGATGCTACACCAAGTGGTAGCCTTTCTATTCCAAAGGCATTGGGAGATCAAGGTGGTTCATTTTCCCCTGAGGAGG
AAGTTGATGCTGTTGAGGAGTCTGGTGGAAATGACGATGAAGTGATGCCTGATGTTGTGAAAACACCGAAAAGGAGGAAT
TCAGGTTTCATTTCTATAGGAGGGATGAAGTTATACACTGAAGATATATCTGGTGAAGAGAGTGATGGAGAAGAAGAGAT
GGATGATGATGAATCTGGAGATGAGGGCAGCAATGGATTTTCTGAATCATCTGAGAGTGACAGCTCGGAAGACATGTTTG
GAAGTAATTCCGAGATTGATGATGCTGTTGCAAAGGATTACTTGGAAGGTATTGGTGGCAGTGAGATTATGTTGGATGCT
CATTGGTTGGCAGAACAGTCATTGGATAAATTGGATTTGTCAAGTGATGACAGTTCTTCAAGTGATTCTTCTGATCGAAA
AACAAGAAAGTTGACTGGTATTGGTCTGCGAAAAGCTTCAATGGAATATGGTAAGAAGAAGACGACAAGAAGTCGTTTCT
CGGGGCATGGTAAGTCTACTAATCCATTGACAATGGATGATCTTATGTTTGTGAAGGATCCAAGAAGTCTTTCAGGGAAG
AAGAACAAGAAGAAAGAGGTGGCTAAGTTTCCCCACTCTTGGCCTTCAGGGGCACCAAAGAGTAAGAATTCCCGTAATTT
TCCTGGTGAGAAAAAGAAACACCGCAAAGAATACATTGCTTTGAAGCGCCGTGAGAGAATGCTGCAGCGTGGTGTTGATC
TTGCTGATATTAACTCTCAATTAGAGAGTTTTGTTCTGGAGAACGTGGACATGCACTGTTTCCAGCGTATGCATAATCGA
GATTGCTCTCAGGTAAGACGATTAGCAGATGTATACCGCTTGTCAAGTAGCTGCAATGGTTCTGGTAAGAAAAGCTTTGT
GACAGTGACTCGAACATATCAGACATGTATGCCATCTGCCAGCGATAAACTTCGCATTGAGAAGCTAATAGGAGCAGGAG
ATGAGGATTATGATTTTGCTGTCAGTGGAGAGGTAAAAGGGAAATCTGGAAGTTTAGATAGGAAGAAAGCAAAAGATTCA
GCCAAAAAGCGAACTACCAGAGAAGAACAGGAGAGAAATAAAAGCAATGGGAAGAAGAGTTCATATGCTGATCAACCTGT
ATCGTTTGTGTCTAGTGGCATAATCGATTCTGAGATAGCTGTTGGAAAAACCTTAGGTGAAAAAGATGCAAAACAGGTAG
CTGAATCTACTCCGGGAACCTCTAATGGAGCAGACATCGGAGCATTTGAGGTACATACCAGAGGTTTTGGATCCAAAATG
ATGGCAAAAATGGGATTCATAGATGGAGGCGGTCTAGGAAAGGATGGTAAGGGGATAGCACAGCCAATAGAAGCTGTTCA
GCGTCCAAAATCACTTGGGTTAGGTCTGGATTTCAACATTGACACTGAAGACCCAACTCCGTCAAGCAATAACAATGCTA
AACGCAACAGATCGTCTTCCTCTGGGAAACATGTGAAACGCATCTCTCATGAAAATGGTGCCTCTGGTTCAGGAGGAATT
AGAGACAAAAGATTGGGAGCCTTTGAGCAGCACACAACAGGCTTTGGGTCGAGGATGATGGCGAGAATGGGTTTCGTAGA
AGGCTCGGGTTTGGGAAGAGAGTCACAAGGCATAGTCAATCCGCTGGTCGCTGTCAGGCGTCCTAGAGCACGTGGAATAG
GCGCTGAAGGCTAA