Details for Lyrate rockcress Locus 16037400

Position : sca3 ( 5`- 3693897 .. 3694421 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_920906 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037400

Protein [Map View]
MENIKNPKNADDCSDSISKNSHQGVDDSLNQSRSYVCSFCIRGFSNAQALGGHMNIHRRDRAKLRQKLMEDNKDDVVAES
DSSEVVSLDLNEQQQQQEALTCDDHDDQDQYVEKDLSPKQKLEFWVQESKLDTNDRGKGTEVSIDGSSSRHHREIEGLDL
ELRLGQSVVEKKTT*

DNA
ATGGAAAACATCAAAAACCCTAAAAACGCAGATGATTGTTCCGATAGCATATCAAAAAACAGTCATCAGGGCGTTGATGA
TTCCCTGAACCAGTCAAGATCTTACGTATGCAGTTTCTGCATAAGGGGCTTCTCGAATGCTCAAGCACTAGGAGGGCATA
TGAACATCCACAGAAGAGACAGAGCTAAACTCAGACAAAAGCTTATGGAAGATAATAAGGATGATGTTGTTGCTGAGAGT
GATTCATCAGAAGTTGTCTCTCTAGACCTTAATGAACAACAACAACAACAAGAAGCTTTGACATGTGATGATCACGATGA
TCAAGATCAATATGTTGAGAAAGATTTAAGTCCTAAACAGAAATTAGAGTTTTGGGTTCAAGAAAGCAAGCTTGATACTA
ATGATCGTGGAAAGGGCACGGAGGTTAGCATAGATGGTTCGAGTTCGAGACATCATCGTGAGATTGAAGGATTGGATCTG
GAGCTTCGGTTAGGCCAAAGCGTCGTGGAGAAGAAGACAACATAA