Details for Lyrate rockcress Locus 16037396

Position : sca3 ( 5`- 8125131 .. 8131834 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037396

Protein [Map View]
MTTRTSKHKRSRSDPVPRKSLKNKKSSETLYNIDRFHMDERLQREIEQLKSLLKSRKLHPKRVSSDEIDLLLQEDEVLVR
REMETVIRRKLFLEDSKNEDSSIPKEAKKLVREIAGLELQVMYLETYLLLLYRRFFNNKITSELKSEGKEISEAILGSTK
VTDSPKNTVCSSQKVVEDSGIFRSHSSLSHCSGYSFRMSPQAMDSSYHRSLPFSMLEQSDIDEMIGTYVSENVHNSPNSL
SEEMIKCILQVFRQLADPESLDDDRETSSPFRGKERLKVICRPYDKLLMVKSICRDPGKLNAVEPALKHFRSLVNKLEGV
NPRKLNHEEKLAFWINIHNSLVMHSIIVYGNPKNSMKRVSGLLKAAYNVGGRSLNLDTIQTSILGCRVFRFLFASRSKGK
AGDLGRDYSITHSEPLLHFALCSGNLSDPSNVMMELECGREEYVKSNLGISKDNKILLPKLVELYAKDTQLCNVGILDMI
GKFLPCEARDRIQQCRNKKHGRFTIDWIWNDYRIFPISVNLHGNSPSLELKSELIDPHSKNSVAQFEISRVLHCDGLLLC
SSHVDESRVLVWNPLTDDNKSWIKSYKMLSYYRGTKYFEIYDFDSDSWRILDDIIAPGGSIGFSELSVSLKGNTYWLARG
ITETPRIISLLKFDFSTDKSVPVPLPYQSRRFEATSLSVVREDKLSVLLQRDKSSKTEIWVTDKIDETTKVMSWSKVLAL
DLSPHLQIWNDASFLLGEEKKVVMCCEKLIDENKVKDMVYIVGEDNVVTEVGFGVDEMDGCRAVIFNYVPSLVQIEQAGG
NRKRGN*

DNA
ATGACGACAAGAACATCGAAACATAAACGTTCTAGAAGCGACCCCGTCCCCAGAAAATCTCTCAAGAACAAGAAATCAAG
TGAAACCCTTTACAACATCGATCGATTTCACATGGATGAACGTTTGCAGAGAGAGATAGAACAGCTAAAATCTCTTCTAA
AGTCCAGAAAATTACATCCCAAGAGAGTCTCAAGTGATGAGATTGATTTGTTGCTTCAAGAAGATGAAGTCTTAGTACGG
CGAGAAATGGAGACAGTCATTCGACGCAAACTGTTCTTGGAAGATTCTAAAAATGAAGATTCTTCTATCCCCAAGGAGGC
AAAGAAACTGGTGAGGGAAATCGCGGGTTTGGAGCTGCAAGTGATGTACTTAGAAACATATCTTCTTTTGTTATATCGAA
GATTCTTCAACAACAAAATTACATCTGAATTAAAATCAGAGGGGAAAGAGATATCAGAAGCTATTCTTGGGAGCACTAAA
GTCACTGATTCACCCAAAAACACAGTCTGCAGTTCGCAGAAAGTTGTAGAAGACTCTGGAATCTTCCGCAGTCACTCATC
CTTGTCTCATTGTTCAGGCTATTCCTTTAGAATGTCTCCCCAAGCAATGGACTCGTCATATCATCGATCTCTTCCTTTCT
CAATGCTTGAGCAATCCGATATCGATGAAATGATCGGGACATATGTTTCTGAAAACGTTCATAATTCACCAAATAGTTTG
TCTGAAGAGATGATCAAGTGCATCTTACAAGTATTTCGTCAACTTGCTGATCCAGAATCACTCGATGATGATCGAGAAAC
AAGCAGTCCTTTCCGCGGGAAAGAGCGACTGAAGGTCATTTGTCGACCTTACGACAAATTATTAATGGTGAAATCGATAT
GTAGAGACCCAGGGAAGTTAAATGCAGTTGAACCTGCTTTGAAACATTTCAGGTCGCTTGTTAATAAGTTAGAAGGAGTG
AATCCAAGGAAGTTAAATCATGAAGAAAAGCTAGCTTTCTGGATTAACATACACAACTCTCTGGTTATGCATTCGATAAT
TGTCTATGGGAACCCTAAAAACAGTATGAAAAGAGTATCTGGGTTGCTGAAGGCAGCGTACAACGTTGGAGGTCGAAGCT
TGAACTTAGATACCATTCAGACTTCAATCCTTGGTTGCCGTGTATTTAGGTTCTTGTTTGCTTCTAGATCAAAAGGTAAA
GCTGGAGATTTAGGAAGAGATTATTCTATAACTCACTCTGAGCCTCTTCTTCATTTCGCTCTTTGCTCGGGGAACTTGTC
AGATCCATCAAACGTGATGATGGAGCTAGAATGTGGTAGAGAAGAGTATGTAAAATCAAACCTAGGAATTTCCAAAGACA
ACAAGATTCTTTTGCCGAAGCTTGTTGAATTATATGCCAAGGATACTCAACTTTGCAACGTCGGTATTCTCGACATGATT
GGGAAATTTTTGCCTTGTGAAGCAAGAGATAGAATCCAGCAGTGTCGGAACAAGAAGCATGGAAGATTCACCATCGATTG
GATTTGGAATGACTACAGGATTTTTCCAATTAGCGTCAATCTCCATGGAAATAGTCCATCTCTAGAGCTTAAAAGTGAGC
TAATCGATCCTCATTCTAAGAATTCAGTAGCTCAATTCGAAATATCTCGAGTCCTTCACTGTGACGGCTTGTTGTTATGC
TCCTCCCATGTCGACGAATCTAGAGTCTTGGTTTGGAATCCTTTAACTGATGACAACAAATCCTGGATCAAGAGCTACAA
AATGTTGAGCTATTATCGTGGTACCAAATATTTTGAAATCTATGATTTTGACTCTGATTCATGGAGGATTCTTGATGATA
TCATCGCTCCAGGCGGGAGCATTGGATTCTCTGAACTTAGCGTGTCTTTGAAGGGAAATACTTACTGGTTGGCTAGAGGT
ATAACAGAAACGCCCCGCATCATATCGTTGCTCAAATTTGATTTTTCAACAGATAAATCTGTACCTGTGCCTCTTCCCTA
TCAGAGTCGTCGTTTCGAAGCTACTAGTCTTTCTGTTGTTAGAGAAGATAAACTTTCTGTGTTATTGCAGCGAGATAAAA
GTTCCAAGACTGAGATATGGGTGACTGATAAGATTGATGAGACCACCAAAGTGATGTCTTGGAGCAAGGTCTTAGCATTG
GATTTGAGCCCTCATCTTCAGATTTGGAATGATGCAAGTTTCTTGCTAGGCGAGGAGAAGAAAGTCGTCATGTGCTGTGA
GAAATTGATTGATGAGAACAAGGTCAAAGACATGGTCTACATTGTTGGGGAGGATAACGTAGTCACAGAAGTGGGATTTG
GAGTAGATGAAATGGATGGATGTCGGGCAGTTATTTTTAATTATGTTCCAAGTTTGGTTCAAATCGAGCAAGCTGGAGGC
AACAGGAAAAGAGGTAACTAA