Details for Lyrate rockcress Locus 16037375

Position : sca3 ( 5`- 2414302 .. 2413759 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037375

Protein [Map View]
MEVAVELELDDDVFFADISKQLNLLITDEDEQNPISLSSSVSFQGLFRGNYQTSATPYMMYNEQINYNARESKGTGVFIP
RSSQPRRKHNHHPHQKKQGRFGSFIPKQQFPHHHVHDYNPTTLNNNNQESITFYHPSTNPRRTYRDAASLFT*

DNA
ATGGAAGTGGCTGTGGAGCTTGAGCTTGATGATGATGTCTTCTTTGCAGACATAAGCAAGCAACTCAATCTCTTAATCAC
AGATGAAGATGAACAAAACCCTATTTCACTTTCCTCTTCTGTCTCTTTCCAGGGTTTGTTCAGAGGAAACTACCAAACAT
CAGCAACACCATATATGATGTACAATGAGCAGATCAATTACAACGCAAGAGAGAGCAAGGGAACAGGAGTGTTCATCCCA
AGATCTTCTCAGCCAAGGAGGAAACATAATCATCATCCTCATCAGAAGAAGCAAGGGAGATTTGGTTCCTTCATCCCCAA
GCAACAGTTTCCTCATCATCATGTTCATGACTACAATCCCACAACTCTCAACAACAACAACCAAGAAAGCATCACCTTTT
ATCATCCTTCTACTAACCCAAGAAGAACCTACAGAGATGCAGCATCTCTTTTCACTTAG