Details for Lyrate rockcress Locus 16037310

Position : sca3 ( 5`- 7452185 .. 7449713 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037310

Protein [Map View]
MASNLPMSPQLEQIHGEIRDHFRALANGFQRLDKIKDSTRQSKQLEELTEKMRECKRLVKEFDRELKDEEARNSPEVNKQ
LNDEKQSMIKELNSYVALRKTYMSTLGNKKVELFDMGAGVSGEPTAEENVQVASSMSNQELVDAGMKRMDETDQAIERSK
QVVEQTLEVGTQTAANLKGQTDQMGRVVNHLDTIQFSIKKASQLVKEIGRQVATDKCIMGFLFLIVCGVVAIIIVKIVNP
NNKDIRDIPGLAPPAQSRKLLYLRNQDYM*

DNA
ATGGCTTCCAATCTTCCTATGAGCCCTCAATTAGAGCAGATCCATGGCGAAATCCGTGACCATTTCCGAGCCCTCGCGAA
TGGTTTCCAGAGGTTGGATAAGATCAAGGATTCAACTAGACAAAGCAAACAACTTGAAGAACTTACTGAGAAGATGAGAG
AGTGTAAAAGGTTGGTCAAGGAGTTCGACCGTGAGCTCAAGGATGAGGAAGCTAGAAATTCTCCTGAAGTAAATAAGCAA
TTGAACGATGAGAAACAATCTATGATCAAGGAGCTCAATTCTTACGTTGCACTAAGAAAAACGTATATGAGTACCCTTGG
CAACAAGAAAGTTGAGCTTTTCGATATGGGAGCTGGAGTTAGTGGCGAACCTACAGCTGAGGAAAATGTTCAAGTGGCTT
CATCTATGTCAAACCAGGAGCTTGTTGATGCTGGAATGAAAAGAATGGATGAGACTGATCAGGCCATTGAGCGCTCAAAA
CAGGTTGTAGAACAAACACTCGAAGTTGGAACTCAAACTGCAGCTAATTTAAAGGGACAGACGGATCAAATGGGACGCGT
TGTTAACCACTTGGACACTATTCAATTCTCAATCAAGAAAGCCTCCCAGCTGGTGAAAGAGATAGGGAGACAGGTGGCTA
CCGATAAATGCATAATGGGGTTCCTGTTTCTCATTGTATGTGGTGTAGTTGCCATTATCATAGTGAAGATCGTGAATCCG
AATAACAAAGACATTAGGGACATCCCAGGATTAGCTCCTCCAGCGCAATCGAGGAAACTATTGTACTTGAGGAATCAAGA
CTACATGTGA